BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31950 (516 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9RDZ2 Cluster: Putative uncharacterized protein; n=5; ... 33 3.9 UniRef50_Q1QB05 Cluster: Phage integrase; n=1; Psychrobacter cry... 32 6.8 >UniRef50_Q9RDZ2 Cluster: Putative uncharacterized protein; n=5; Legionella pneumophila|Rep: Putative uncharacterized protein - Legionella pneumophila Length = 505 Score = 33.1 bits (72), Expect = 3.9 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +1 Query: 70 LSVKLSDTECWKSSSRSKYWNSHHFEKKTEVILRLEFDLKKFIRLQCWHY 219 LS LS + + + Y+N+ H+ T + L L+ LK FIR C++Y Sbjct: 191 LSAILSSSTATVTEAAETYFNNPHYYFPTHLPLYLQIGLKIFIRKWCFNY 240 >UniRef50_Q1QB05 Cluster: Phage integrase; n=1; Psychrobacter cryohalolentis K5|Rep: Phage integrase - Psychrobacter cryohalolentis (strain K5) Length = 462 Score = 32.3 bits (70), Expect = 6.8 Identities = 14/49 (28%), Positives = 30/49 (61%) Frame = +1 Query: 121 KYWNSHHFEKKTEVILRLEFDLKKFIRLQCWHY*SVKQSDVTTDIDGYQ 267 KY NS+H+++ + ILR + L ++ +Y + +S +TT+++ +Q Sbjct: 134 KYVNSYHYKESPKEILRHQNRLLVSLKSNTDNYKKISKSRITTEVNSHQ 182 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 424,933,632 Number of Sequences: 1657284 Number of extensions: 7403163 Number of successful extensions: 13030 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13029 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -