BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31949 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15120.1 68416.m01913 AAA-type ATPase family protein contains... 29 2.5 At4g29780.1 68417.m04241 expressed protein 27 5.7 At4g13180.1 68417.m02050 short-chain dehydrogenase/reductase (SD... 27 9.9 At1g30520.1 68414.m03734 acyl-activating enzyme 14 (AAE14) ident... 27 9.9 At1g01600.1 68414.m00077 cytochrome P450, putative similar to cy... 27 9.9 >At3g15120.1 68416.m01913 AAA-type ATPase family protein contains PROSITE domains, PS00674: AAA-protein family signature and PS00017: ATP/GTP-binding site motif A (P-loop) Length = 1954 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +2 Query: 161 QCVT*CHPDINKLVTRPLELLFSLVKRENYVSAVSMLNI 277 QCV+ ++KLVTR L L S + E AVS L++ Sbjct: 1797 QCVSILQDSMHKLVTRELRLGRSSITTEGIHDAVSSLSV 1835 >At4g29780.1 68417.m04241 expressed protein Length = 540 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 234 TKLKRSSKGRVTNLLMSG*HYVTH*PLSDHILYIKCYIGKRHFDVN 97 TK K S ++ N++ G Y TH P+ +++ Y KRH + N Sbjct: 310 TKAKFESVHKIPNVV--GSIYTTHIPIIAPKVHVAAYFNKRHTERN 353 >At4g13180.1 68417.m02050 short-chain dehydrogenase/reductase (SDR) family protein similar to short-chain type dehydrogenase/reductase SP:Q08632 [Picea abies] Length = 263 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = -3 Query: 490 VVTGAHRHLQRKCATHLENISSKISV 413 +VTGA R + R+ A HL ++ +++++ Sbjct: 19 IVTGATRGMGREIAIHLHSLGARVTI 44 >At1g30520.1 68414.m03734 acyl-activating enzyme 14 (AAE14) identical to acyl-activating enzyme 14 [Arabidopsis thaliana]; similar to SP|Q42524 4-coumarate--CoA ligase 1 (EC 6.2.1.12) (4-coumaroyl-CoA synthase 1) {Arabidopsis thaliana}; contains Pfam profile PF00501: AMP-binding enzyme; identical to cDNA acyl-activating enzyme 14 (At1g30520) GI:29893263 Length = 560 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +1 Query: 370 VMRFGLKGGAAVVTILRS*NLYSQGGWRIYVVDVYGLQ*PLNIRWAV 510 ++R GL+ G V + +L+ + W + V V G+ PLN RW++ Sbjct: 49 LIRLGLRNGDVVSIAAFNSDLFLE--WLLAVALVGGVVAPLNYRWSL 93 >At1g01600.1 68414.m00077 cytochrome P450, putative similar to cytochrome P450 GI:10442763 from [Triticum aestivum] Length = 554 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 37 NNKFFRHDVYHMIAFNMAFKIYIKMAFSYI 126 + KF HD Y +AFN +I + +Y+ Sbjct: 440 DGKFINHDQYRFVAFNAGPRICLGKDLAYL 469 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,209,590 Number of Sequences: 28952 Number of extensions: 228358 Number of successful extensions: 422 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -