BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31946 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0545 - 4756266-4757510 30 0.96 03_01_0555 + 4132630-4132923,4133514-4133771,4134125-4134249,413... 27 8.9 >05_01_0545 - 4756266-4757510 Length = 414 Score = 30.3 bits (65), Expect = 0.96 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -3 Query: 373 CKPS**YLRWRRQCX*VYRTSPR*CASFQ-QLYVPAP 266 C P+ Y R RQC Y P CA+FQ + +VP+P Sbjct: 346 CLPNRPYQRTPRQCAAFYAAPPVDCAAFQCKPFVPSP 382 >03_01_0555 + 4132630-4132923,4133514-4133771,4134125-4134249, 4134789-4134990,4135172-4135297,4135404-4135660, 4135968-4136075,4136142-4136310,4136378-4136543, 4136967-4136998,4137256-4137579,4137683-4137757, 4138093-4138162,4138228-4138385,4138872-4139021 Length = 837 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 352 DTIKRVCKDYHERIARLEXEKFDLXYIV 435 +T ++C+ Y E A + KFDL YIV Sbjct: 643 ETGPKICQKYIECPALFQGRKFDLRYIV 670 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,976,438 Number of Sequences: 37544 Number of extensions: 115540 Number of successful extensions: 254 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 254 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -