BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31925 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80845-1|AAK39181.1| 1217|Caenorhabditis elegans Prion-like-(q/n... 30 1.1 AC024798-10|AAK29912.1| 254|Caenorhabditis elegans Hypothetical... 27 6.0 >U80845-1|AAK39181.1| 1217|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 15 protein. Length = 1217 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = -2 Query: 476 LFANNFNITYFTVFFKSSKTISQDIRSSAHIVCSFQGVVLYTRL 345 LF+N FN ++ +FK +K +++D+ +H+ + VL RL Sbjct: 340 LFSNEFNSCFYLEYFK-NKNLNEDLLRVSHVWVAVGNRVLRVRL 382 >AC024798-10|AAK29912.1| 254|Caenorhabditis elegans Hypothetical protein Y48G9A.12 protein. Length = 254 Score = 27.5 bits (58), Expect = 6.0 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -2 Query: 437 FFKSSKTISQDIRSSAHIVCSFQGVVLYTR-LVDQWS*MFTLYN 309 FF S +T S D H C+F V L + ++++S +F+L N Sbjct: 173 FFASRQTFSGDFGLKLHKFCNFPRVFLLSESFLERYSVVFSLEN 216 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,446,033 Number of Sequences: 27780 Number of extensions: 225545 Number of successful extensions: 520 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -