BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31925 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36560.1 68417.m05191 hypothetical protein 27 7.5 At1g09160.2 68414.m01023 protein phosphatase 2C-related / PP2C-r... 27 9.9 At1g09160.1 68414.m01022 protein phosphatase 2C-related / PP2C-r... 27 9.9 >At4g36560.1 68417.m05191 hypothetical protein Length = 110 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 89 YLHSFETRYASFCHLLSSVYIAIHTGEDRQEWRRI 193 +L+ E +Y+ + HL +Y+ I + EWR I Sbjct: 31 FLNFLEKKYSPYLHLFVILYLIIISTIKHSEWRGI 65 >At1g09160.2 68414.m01023 protein phosphatase 2C-related / PP2C-related similar to GB:AAC16260 Length = 428 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 128 HLLSSVYIAIHTGEDRQEWRRIIQEKVIRG 217 HLL +V AI G R EW + + ++ G Sbjct: 87 HLLENVVSAIPQGASRDEWLQALPRALVAG 116 >At1g09160.1 68414.m01022 protein phosphatase 2C-related / PP2C-related similar to GB:AAC16260 Length = 428 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 128 HLLSSVYIAIHTGEDRQEWRRIIQEKVIRG 217 HLL +V AI G R EW + + ++ G Sbjct: 87 HLLENVVSAIPQGASRDEWLQALPRALVAG 116 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,543,080 Number of Sequences: 28952 Number of extensions: 205773 Number of successful extensions: 370 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -