BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31924 (405 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.33 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 24 0.75 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 5.3 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.0 bits (52), Expect = 0.33 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = +2 Query: 218 LERAGD**ETGAQDQGRLRRL---REEHPGGDQED 313 + RAG E +D +L R RE H GG QED Sbjct: 1403 ISRAGSRDEDSTRDSTKLDRSSREREVHNGGQQED 1437 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 23.8 bits (49), Expect = 0.75 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +3 Query: 63 LEQSRQNIERTAEELRKAHPDVEKNATALREKLQAAVQNTVQES-QKLAKKVSSNVQETN 239 +EQ QN++ + H ++KNA +K + ++Q+S +KL K S E Sbjct: 48 MEQDDQNLKCYLKCFMTKHGILDKNAEVDVQKALRHLPRSMQDSTKKLFNKCKSIQNEDP 107 Query: 240 EKLAPKIKAAYDDF 281 + A ++ Y +F Sbjct: 108 CEKAYQLVKCYVEF 121 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 5.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 87 RCSASTVPKPPWPCRSRLRALPGDS 13 R S S P+PP R R P DS Sbjct: 556 RASLSKTPQPPQCPRFRKLDSPSDS 580 Score = 20.6 bits (41), Expect = 7.0 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +3 Query: 102 ELRKAHPDVEKNATALREKLQAAVQNTVQESQKLAKKVSSNVQETNE 242 EL K PD+ T EKL A + T Q+ Q A++ Q+ + Sbjct: 387 ELLKKIPDLRTLNTLHSEKL-LAFKMTEQQQQMQAQQQHQQQQQQTQ 432 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,498 Number of Sequences: 438 Number of extensions: 1159 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10132494 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -