BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31922 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A3.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces... 30 0.24 SPAC1071.04c |||signal peptidase subunit |Schizosaccharomyces po... 25 5.1 SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe... 25 8.9 >SPBC29A3.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 398 Score = 29.9 bits (64), Expect = 0.24 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +3 Query: 435 EVVVSAGAINSPQLLXLSGIGPRKHLE 515 ++VV+AGAI P LL +S I +KH E Sbjct: 290 DIVVNAGAIALPILLKMSSIMKKKHTE 316 >SPAC1071.04c |||signal peptidase subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 167 Score = 25.4 bits (53), Expect = 5.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 36 LPYFKKSESFMGKFDAEATKYHSKGGY 116 +P + S+ F KFD E T + +K GY Sbjct: 1 MPKYNVSD-FKSKFDKELTNHFNKNGY 26 >SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe|chr 1|||Manual Length = 371 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 40 PTLRKVKASWVNLTRRRLNTTAKAVISXXLL 132 P+ + +W+ LT ++ AKAV+S +L Sbjct: 210 PSKGPISGNWLQLTYAEPSSAAKAVLSNGML 240 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,594,716 Number of Sequences: 5004 Number of extensions: 22367 Number of successful extensions: 38 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -