BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31922 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66494-4|CAA91263.1| 599|Caenorhabditis elegans Hypothetical pr... 67 6e-12 U23168-5|ABD63247.1| 2702|Caenorhabditis elegans Temporarily ass... 27 8.0 U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily ass... 27 8.0 >Z66494-4|CAA91263.1| 599|Caenorhabditis elegans Hypothetical protein C34C6.4 protein. Length = 599 Score = 67.3 bits (157), Expect = 6e-12 Identities = 49/175 (28%), Positives = 72/175 (41%), Gaps = 9/175 (5%) Frame = +3 Query: 15 GWSFXEVLPYFKKSESFMGKFDAEATKYHSKGGYLXVXSDDNMHEIEDLIIKAAXEL*LK 194 GW++ LPYFKK+E++ Y G L V D + + + E L Sbjct: 149 GWNYANCLPYFKKAETYSDATGPN-DPYRGNNGPLYVKKGDAENPLHKAWLNVGKEHPLG 207 Query: 195 NLTDCNGDSQIGVMXXXXXXXXXXXXXXXXXXLSPIXDRKNLHVIKNAIATKIVFKPGXN 374 D NG+ Q G+ + PI +R NL T+++F Sbjct: 208 WTNDMNGEKQEGISTMDMTIHNGERWSASKAYVHPIRNRPNLITSSGITCTRVLFDTNKA 267 Query: 375 IXSGXLX--NKGGRDIAVNVXKE-------VVVSAGAINSPQLLXLSGIGPRKHL 512 I + N G D + +E V+++ GAIN+PQLL LSG+GP HL Sbjct: 268 IGIEFIRKLNFVGTDSIDSYSREKIYCQGDVILAGGAINTPQLLMLSGVGPADHL 322 >U23168-5|ABD63247.1| 2702|Caenorhabditis elegans Temporarily assigned gene nameprotein 308, isoform e protein. Length = 2702 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 113 TAFAVVFSRLRVKFTHEAFTFLKVGQDFLET 21 T F VF +F H AF F VG++ +ET Sbjct: 2262 TEFRTVFVSEDHQFVHGAFGFRAVGEEHIET 2292 >U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily assigned gene nameprotein 308, isoform c protein. Length = 7548 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 113 TAFAVVFSRLRVKFTHEAFTFLKVGQDFLET 21 T F VF +F H AF F VG++ +ET Sbjct: 7108 TEFRTVFVSEDHQFVHGAFGFRAVGEEHIET 7138 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,920,206 Number of Sequences: 27780 Number of extensions: 128736 Number of successful extensions: 203 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 202 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -