BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31920 (516 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6RSV6 Cluster: Putative uncharacterized protein; n=2; ... 33 3.9 >UniRef50_A6RSV6 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 1195 Score = 33.1 bits (72), Expect = 3.9 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +1 Query: 34 RGVRRLTLPVHCLVETVGLTTR*EHGAGDWNKIASESNGF*LSLGNE 174 R VR T + CL E GLTT E GAGD + ++ G L+ G + Sbjct: 632 RLVRNYTQNIDCLEEREGLTTDLELGAGDRTRFQTKIQGKSLTAGTD 678 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 464,840,428 Number of Sequences: 1657284 Number of extensions: 8348921 Number of successful extensions: 15579 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 15323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15577 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -