BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31920 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69903-2|CAA93774.1| 364|Caenorhabditis elegans Hypothetical pr... 29 2.0 AL021474-6|CAI79259.1| 261|Caenorhabditis elegans Hypothetical ... 27 8.0 >Z69903-2|CAA93774.1| 364|Caenorhabditis elegans Hypothetical protein F46F2.4 protein. Length = 364 Score = 29.1 bits (62), Expect = 2.0 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = +3 Query: 147 WILIVFRQ*TGLFRYCRYGSVTYDQKMRIHTSRSDREFQ 263 WI ++ +G+ CRYG + + + M ++T D+++Q Sbjct: 38 WIANIWIFASGVVAGCRYGCINFKKTMTMNTQALDQDWQ 76 >AL021474-6|CAI79259.1| 261|Caenorhabditis elegans Hypothetical protein Y32F6A.6 protein. Length = 261 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -3 Query: 445 ALTTFNKYDDV*IDINFTQIDLIFNRFAPSVALEKAF 335 AL +FNK + ID ++++ ++NR + +E+ F Sbjct: 121 ALESFNKRQSINIDYVYSKMTELYNRMLVTQGIERVF 157 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,953,922 Number of Sequences: 27780 Number of extensions: 209642 Number of successful extensions: 387 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -