Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31920
         (516 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g63240.1 68416.m07105 endonuclease/exonuclease/phosphatase fa...    29   1.9  

>At3g63240.1 68416.m07105 endonuclease/exonuclease/phosphatase
           family protein similar to inositol polyphosphate
           5-phosphatase I (GI:10444261) and II (GI:10444263)
           [Arabidopsis thaliana]; contains Pfam profile PF03372:
           Endonuclease/Exonuclease/phosphatase family
          Length = 547

 Score = 29.1 bits (62), Expect = 1.9
 Identities = 12/37 (32%), Positives = 22/37 (59%)
 Frame = +3

Query: 36  WCATIDFASALSCRNCRSYDPVRAWSRRLE*DRIRIQ 146
           W   +++  ALS R+ ++   +R W   LE D++RI+
Sbjct: 391 WLGDLNYRIALSYRSAKALVEMRDWRALLEKDQLRIE 427


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,146,495
Number of Sequences: 28952
Number of extensions: 189367
Number of successful extensions: 327
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 324
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 327
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 937669760
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)