BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31919 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.02 |||ClC chloride channel|Schizosaccharomyces pombe|chr... 54 2e-08 SPBC3E7.09 |||Sad1-UNC-like C-terminal|Schizosaccharomyces pombe... 26 2.9 SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2... 25 8.9 >SPBC887.02 |||ClC chloride channel|Schizosaccharomyces pombe|chr 2|||Manual Length = 667 Score = 53.6 bits (123), Expect = 2e-08 Identities = 27/92 (29%), Positives = 50/92 (54%) Frame = +1 Query: 148 LLSTWTFGLAVSSGLFIPNLLTGAAWGRLLAISIQYMLPSKTINPAKYXXXXXXXXXXXX 327 LL++ TFG A+ +G+ +P+L GA GR + ++ PS + Y Sbjct: 396 LLTSATFGAAIPTGIIVPSLAIGACIGRAVGTLLKSRFPS-LAGTSIYGVIGSIAFLSST 454 Query: 328 XRMTISLTVIIIETTGQISNALPIMITLVVAQ 423 R+ ++L VI+ E TG ++ ALP+M+ ++++ Sbjct: 455 TRLVVALVVILFELTGALNIALPLMLATLISK 486 >SPBC3E7.09 |||Sad1-UNC-like C-terminal|Schizosaccharomyces pombe|chr 2|||Manual Length = 659 Score = 26.2 bits (55), Expect = 2.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 236 SNLPHAAPVSRFGMNKPLETARP 168 S LP P +R N P+E +RP Sbjct: 575 SRLPENLPTTRSSSNNPIEASRP 597 >SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2|||Manual Length = 479 Score = 24.6 bits (51), Expect = 8.9 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +2 Query: 56 KRPKRRYDRSST 91 K+PKRRY +SST Sbjct: 372 KKPKRRYSKSST 383 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,152,672 Number of Sequences: 5004 Number of extensions: 44133 Number of successful extensions: 114 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -