BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31919 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 8.1 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 8.1 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 8.1 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 218 PRGEDCSLYPYSTCYLPRLLTQPSTRWSVRPLN 316 P DC+ ++ CY P +T V LN Sbjct: 76 PACRDCAKGNHTDCYHPACITADGVERGVMSLN 108 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.6 bits (46), Expect = 8.1 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 3/26 (11%) Frame = +1 Query: 340 ISLTV---IIIETTGQISNALPIMIT 408 +SLTV ++ ET Q+S+A+P++ T Sbjct: 271 LSLTVFLNLVAETLPQVSDAIPLLGT 296 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +3 Query: 342 IINGHYYRDDGTDIKRPTHHDHAGRGPN 425 + NG+ R+ G I HH H + P+ Sbjct: 100 VANGNANREAGMKINLLNHHQHHHQHPH 127 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 556,616 Number of Sequences: 2352 Number of extensions: 11288 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -