BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31918 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21380.1 68417.m03089 S-locus protein kinase, putative (ARK3)... 28 3.2 At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type f... 27 9.9 >At4g21380.1 68417.m03089 S-locus protein kinase, putative (ARK3) identical to PIR|T05180|T05180 S-receptor kinase ARK3 precursor - [Arabidopsis thaliana] Length = 850 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 145 SDASEVFRALSGFKVRNRSLYRDRSGMYANVSRTVPGCG 261 S+ S V + GFK RN ++ R G V +T+ CG Sbjct: 310 SNTSPVCNCIKGFKPRNPQVWGLRDGSDGCVRKTLLSCG 348 >At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 117 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 Query: 208 RDRSGMYANVSRTVPGCGVSGELFW 282 +DR G N R P CG G +W Sbjct: 39 KDRGGCTINCFRADPVCGTDGVTYW 63 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,616,804 Number of Sequences: 28952 Number of extensions: 177826 Number of successful extensions: 442 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -