BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31913 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 3.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.1 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 8.1 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 8.1 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 8.1 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.8 bits (49), Expect = 3.5 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = +2 Query: 215 RDTLMKQKVAESVLQRVVGEEAPKVL---HKQFNSPINLYSEQNIANSIRQXTSPLPT 379 R T Q+ + + + + AP+V H Q N +LYS +N + R P P+ Sbjct: 1072 RITSALQQDWDETRRELAEQGAPRVADNQHNQDNDRTSLYSARNTSEEQRGRRHPTPS 1129 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 6.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 55 PKHPEVRSCQQLAVPHHSSR 114 P H E R C L HH R Sbjct: 687 PCHQECRGCHGLGDDHHECR 706 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 77 LLTSGCLGCLVSVREEVGVE 18 LLTS C G + ++R E+G + Sbjct: 38 LLTSYCDGAVRTIRSELGAD 57 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 22.6 bits (46), Expect = 8.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 118 PGS*GPKGAWPHRELPASSPQPXNEGT 198 PG G KGA R P S P +GT Sbjct: 108 PGPMGLKGAKGVRGFPGSEGLPGEKGT 134 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.6 bits (46), Expect = 8.1 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 336 TLQTLSGSXLRLCQLTAITDGRTLSRGKSFTRNATMQQST 455 T L G R+C+ TDG R F +A ++T Sbjct: 293 TSTALDGQRTRVCKCMHFTDGPDCDRCLPFYNDAPWGRAT 332 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,626 Number of Sequences: 2352 Number of extensions: 11842 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -