BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31913 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 22 4.3 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 7.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 7.5 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -1 Query: 144 GSLRTLAPGSTRGVVRYGQLL 82 G + ++PG T+ +V +G+L+ Sbjct: 77 GPYKWISPGDTKVMVEHGELV 97 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/40 (25%), Positives = 18/40 (45%) Frame = +3 Query: 261 EWLAKRHLRCCTSNSTLQSIYTRNRTLQTLSGSXLRLCQL 380 +W++ + + L +TL T +GS L +C L Sbjct: 80 KWISPGDTKVMVEHGELVMGILCKKTLGTSAGSLLHICML 119 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 61 HPEVRSCQQLAVPH 102 H + R C QLA+ H Sbjct: 495 HEDKRGCYQLAINH 508 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 61 HPEVRSCQQLAVPH 102 H + R C QLA+ H Sbjct: 585 HEDKRGCYQLAINH 598 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,299 Number of Sequences: 438 Number of extensions: 3307 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -