BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31913 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family... 29 2.5 At3g03950.2 68416.m00414 expressed protein contains Pfam profile... 29 2.5 At3g03950.1 68416.m00413 expressed protein contains Pfam profile... 29 2.5 At3g44200.1 68416.m04739 protein kinase family protein contains ... 28 3.2 At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 28 3.2 At2g28830.1 68415.m03505 armadillo/beta-catenin repeat family pr... 28 3.2 At5g03890.1 68418.m00365 hypothetical protein 27 5.7 At3g04610.1 68416.m00493 KH domain-containing protein similar pu... 27 7.5 At3g05430.1 68416.m00595 PWWP domain-containing protein contains... 27 9.9 >At3g24860.1 68416.m03118 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 310 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 88 LAVPHHSSRAPGS*GPKGAW--PHRELPASSPQPXNEGTS*P 207 +A P +S P P A PH++ P S PQP N + P Sbjct: 1 MATPSPTSSPPSDSNPNSAATPPHQKQPPSPPQPTNPSSPPP 42 >At3g03950.2 68416.m00414 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 424 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 227 MKQKVAESVLQRVVGEEAPKVLHKQFNSPINLYSEQNIANSIRQXT-SPLPT 379 MKQ V+ LQR GE P+ K I YSE ++ N I+ S PT Sbjct: 217 MKQDVSAVDLQRYNGENFPESFVKAKFFVIKSYSEDDVHNCIKYGAWSSTPT 268 >At3g03950.1 68416.m00413 expressed protein contains Pfam profile PF04146: YT521-B-like family Length = 425 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 227 MKQKVAESVLQRVVGEEAPKVLHKQFNSPINLYSEQNIANSIRQXT-SPLPT 379 MKQ V+ LQR GE P+ K I YSE ++ N I+ S PT Sbjct: 218 MKQDVSAVDLQRYNGENFPESFVKAKFFVIKSYSEDDVHNCIKYGAWSSTPT 269 >At3g44200.1 68416.m04739 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 941 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +2 Query: 278 APKVLHKQFNSPINLYSEQNIANSIRQXTSPLPTNGHYGRPHVVKRQVFY*KRHNA 445 AP LH + + +N +S+ S+ S L N + PH V V + RH++ Sbjct: 702 APLPLHVEPSHQVNSHSDNK--TSVMSQNSALEKNNSHSHPHPVVDDVIHVIRHSS 755 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/34 (35%), Positives = 24/34 (70%) Frame = +3 Query: 408 SRGKSFTRNATMQQSTHILIDALMLLSIYYAIFR 509 S+ ++ ++A+M++ ++ D L LLSIYY++ R Sbjct: 2332 SKKRALAQSASMEEQ--VIADGLKLLSIYYSVCR 2363 >At2g28830.1 68415.m03505 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 654 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 240 WQSRCCSEWLAKRHLRCCTSNSTLQS-IYTRNRTLQTL 350 ++ C +WL HL C + TL S I T N L++L Sbjct: 281 YERECIKKWLEGGHLTCPKTQETLTSDIMTPNYVLRSL 318 >At5g03890.1 68418.m00365 hypothetical protein Length = 179 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 319 IDWRVELLVQHLRCLFANHSLQHRLCHLL 233 +++R + V H+ F+ HS+ H HLL Sbjct: 22 LEYREPISVHHILTQFSGHSISHNNTHLL 50 >At3g04610.1 68416.m00493 KH domain-containing protein similar putative nucleic acid binding protein GB:CAB39665 [Arabidopsis thaliana]; Pfam HMM hit: KH domain family of RNA binding proteins Length = 577 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = +2 Query: 170 HHPNPXMRAPPNHD--YRDTLMKQKVAESVLQRVV---GEEAPKVLHKQFNSPI 316 H+P P M+ PP HD Y M+Q E + + G E P +H P+ Sbjct: 400 HNPPPYMQPPPRHDSYYPPPEMRQPPMEKQPHQGISAYGREPPMNVHVSSAPPM 453 >At3g05430.1 68416.m00595 PWWP domain-containing protein contains Pfam profile:PF00855 PWWP domain Length = 965 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 312 QSIYTRNRTLQTLSGSXLRLCQLTAITDGRTLSRGKSFTRNATMQQST 455 +S+Y +T + L+ + LR+ ++ TL KS+T+ ++ ST Sbjct: 327 RSVYCLMKTHEPLNRAPLRVPLSGSLVSAETLGNPKSYTKAMNVKDST 374 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,503,547 Number of Sequences: 28952 Number of extensions: 245321 Number of successful extensions: 649 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -