BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31911 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 28 0.21 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 27 0.50 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 27.9 bits (59), Expect = 0.21 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 366 HCHGLHRPSLHRPSLHGPSLHCPSLHRPSLHRPNL-RSPSIHRP 494 H + H P P+ + CP+ RP H+ NL R ++H P Sbjct: 401 HMNYYHNPDYVAPTPKAKTHICPTCKRPFRHKGNLIRHMAMHDP 444 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 26.6 bits (56), Expect = 0.50 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +3 Query: 366 HCHGLHRPSLHRPSLHGPSLHCPSLHRPSLHRPNLRSP---SIHRPSIYCPGL 515 H H P L H PS+H P+ H P ++P + H P + PGL Sbjct: 119 HQHHHQHPHLPHVQQHHPSVHHPA-HHPLHYQPAAAAAMHHHHHHPHHHHPGL 170 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 239,610 Number of Sequences: 2352 Number of extensions: 2862 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -