BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31908 (511 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 51 7e-09 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 49 2e-08 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 27 0.13 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 24 0.68 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 24 0.91 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 21 8.4 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 21 8.4 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 8.4 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 50.8 bits (116), Expect = 7e-09 Identities = 27/82 (32%), Positives = 43/82 (52%) Frame = +2 Query: 260 LPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQ 439 L ++ FS+F K R A L +F ++ + A YAR +N +F YA +AI+ Sbjct: 74 LERDANFSLFIPKHRRIAGRLIDIFLGMRNVDDLLSVAVYARDRVNPYLFSYALSVAILH 133 Query: 440 RSDTASFVLPAPYEAYPQYFVN 505 R DT LP+ E++P +V+ Sbjct: 134 RQDTQDIDLPSFIESFPDKYVD 155 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 49.2 bits (112), Expect = 2e-08 Identities = 24/82 (29%), Positives = 44/82 (53%) Frame = +2 Query: 260 LPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQ 439 L ++ FS+F K R+ A L ++F A+ + A + R +N +F YA+ +A++ Sbjct: 74 LGRHENFSLFIPKHRKVAGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLFYYAFSVALLH 133 Query: 440 RSDTASFVLPAPYEAYPQYFVN 505 R DT + LP+ +P +V+ Sbjct: 134 RPDTQNLDLPSFIHVFPDKYVD 155 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 26.6 bits (56), Expect = 0.13 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 290 YEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAII 436 Y+K + + + + + YYA F T+ + ++ G FL Y+I +I Sbjct: 1203 YKKKKFQRMVVARYVYYATIFTIITATSSFVTIHNVIGQFL-GYFIGLI 1250 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 24.2 bits (50), Expect = 0.68 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 377 SMLFCRNIQNLWHNRTA*TARWLLPS 300 S FC N+Q + N+ + T W LP+ Sbjct: 205 SYQFCDNLQYSFDNQCSGTIDWALPN 230 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 23.8 bits (49), Expect = 0.91 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 377 SMLFCRNIQNLWHNRTA*TARWLLP 303 S FC N+Q + N+ + T W LP Sbjct: 196 SYQFCDNLQYSFDNQCSGTIDWALP 220 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 8.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 208 HKHESLRKFHDDVQGRIPSQEFGILDLLRKNE 303 H E +F++ + +PS ILDLL E Sbjct: 605 HCPEGFNEFYNQRRRWMPSTMANILDLLMDYE 636 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 208 HKHESLRKFHDDVQGRIPSQEFGILDLL 291 H E +F++ + +PS I+DLL Sbjct: 865 HAPEGFNEFYNQRRRWVPSTIANIMDLL 892 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 208 HKHESLRKFHDDVQGRIPSQEFGILDLL 291 H E +F++ + +PS I+DLL Sbjct: 865 HAPEGFNEFYNQRRRWVPSTIANIMDLL 892 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 208 HKHESLRKFHDDVQGRIPSQEFGILDLLRKNE 303 H E +F++ + +PS ILDLL E Sbjct: 838 HCPEGFNEFYNQRRRWMPSTMANILDLLMDYE 869 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 208 HKHESLRKFHDDVQGRIPSQEFGILDLLRKNE 303 H E +F++ + +PS ILDLL E Sbjct: 838 HCPEGFNEFYNQRRRWMPSTMANILDLLMDYE 869 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 208 HKHESLRKFHDDVQGRIPSQEFGILDLL 291 H E +F++ + +PS I+DLL Sbjct: 865 HAPEGFNEFYNQRRRWVPSTIANIMDLL 892 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 208 HKHESLRKFHDDVQGRIPSQEFGILDLL 291 H E +F++ + +PS I+DLL Sbjct: 865 HAPEGFNEFYNQRRRWVPSTIANIMDLL 892 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 20.6 bits (41), Expect = 8.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 403 NVLIRLLHSYY 435 NVL +L+H YY Sbjct: 107 NVLFQLIHVYY 117 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 20.6 bits (41), Expect = 8.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 403 NVLIRLLHSYY 435 NVL +L+H YY Sbjct: 107 NVLFQLIHVYY 117 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 20.6 bits (41), Expect = 8.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 403 NVLIRLLHSYY 435 NVL +L+H YY Sbjct: 427 NVLFQLIHVYY 437 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,604 Number of Sequences: 336 Number of extensions: 2377 Number of successful extensions: 15 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12154132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -