BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31908 (511 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1D7.05 |byr2|ste8, SPBC2F12.01|MAP kinase kinase kinase Byr2... 25 5.0 SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyc... 25 5.0 SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe... 25 5.0 SPBC776.06c |||spindle pole body interacting protein |Schizosacc... 25 6.6 SPAC10F6.09c |psm3|smc3|mitotic cohesin complex subunit Psm3|Sch... 25 6.6 SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 25 8.7 >SPBC1D7.05 |byr2|ste8, SPBC2F12.01|MAP kinase kinase kinase Byr2|Schizosaccharomyces pombe|chr 2|||Manual Length = 659 Score = 25.4 bits (53), Expect = 5.0 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 157 VLQSRPGLQHRGQQGLLHKHESLRKFHDDVQGRIPSQEFGILDLLRKN 300 + Q+ GL++ +G++H+ D +G+I +FGI L N Sbjct: 503 IKQTLKGLEYLHSRGIVHRDIKGANILVDNKGKIKISDFGISKKLELN 550 >SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 615 Score = 25.4 bits (53), Expect = 5.0 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = -1 Query: 409 EHSLVHVDSGVACCFVETFKIFGIIEQLEQRDGFFPHFFVKDREFQILGKESDLVHHH 236 ++ +++VD +A CFV+ + G LE+ + + + + + F +LG+ L+ HH Sbjct: 539 DNLILNVDGCIAVCFVDLLRNCGAF-TLEEANEYI-NLGILNGMF-VLGRSIGLIGHH 593 >SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 488 Score = 25.4 bits (53), Expect = 5.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 265 GKESDLVHHHEIFVGFHVCVAVLAGLDVEVLG 170 G S +HHH++ + H + L G EV G Sbjct: 279 GSRSGAIHHHDVRIANHQ-IGTLQGHSSEVCG 309 >SPBC776.06c |||spindle pole body interacting protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 25.0 bits (52), Expect = 6.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 98 KQKKILSLFYNVNEINYE 151 K+ + SLF NV++IN+E Sbjct: 60 KKSNVFSLFSNVDDINFE 77 >SPAC10F6.09c |psm3|smc3|mitotic cohesin complex subunit Psm3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1194 Score = 25.0 bits (52), Expect = 6.6 Identities = 16/66 (24%), Positives = 33/66 (50%) Frame = +2 Query: 86 AFVEKQKKILSLFYNVNEINYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLP 265 AF++++++I + + E+N+ E +V + N E YTN+ + + L Sbjct: 259 AFIQREERIERIKAEITELNHSLELLRVEKQQNDED----YTNIMK-SKVALELQSSQLS 313 Query: 266 KNLEFS 283 + +EFS Sbjct: 314 RQIEFS 319 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 24.6 bits (51), Expect = 8.7 Identities = 13/55 (23%), Positives = 25/55 (45%) Frame = +2 Query: 110 ILSLFYNVNEINYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNL 274 I S ++++ +E E+Y +AQD + D + + + F+PK L Sbjct: 702 IASAYFSLKNEKFENEFYLLAQDLRRKIMSDVIIKTSKH---LEEFSEKFIPKKL 753 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,988,274 Number of Sequences: 5004 Number of extensions: 38952 Number of successful extensions: 115 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -