BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31908 (511 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70686-10|CAD21656.1| 533|Caenorhabditis elegans Hypothetical p... 28 3.4 Z70683-8|CAD21626.1| 533|Caenorhabditis elegans Hypothetical pr... 28 3.4 Z92838-2|CAB07408.1| 211|Caenorhabditis elegans Hypothetical pr... 28 4.5 U58086-1|AAC47123.1| 803|Caenorhabditis elegans CUL-4 protein. 28 4.5 U29536-1|AAA68791.3| 840|Caenorhabditis elegans Cullin protein ... 28 4.5 >Z70686-10|CAD21656.1| 533|Caenorhabditis elegans Hypothetical protein F13B12.6 protein. Length = 533 Score = 28.3 bits (60), Expect = 3.4 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -1 Query: 352 KIFGIIEQLEQRDGFFPHFFV-KDRE-FQILGKESDLVHHHEIF--VGFH 215 +I+G RDG F HF V K +E +Q LG ++ V H E+F V +H Sbjct: 424 RIWGYTVSYASRDGSFKHFLVEKIKEGYQFLG--TNQVVHDELFDLVAYH 471 >Z70683-8|CAD21626.1| 533|Caenorhabditis elegans Hypothetical protein F13B12.6 protein. Length = 533 Score = 28.3 bits (60), Expect = 3.4 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -1 Query: 352 KIFGIIEQLEQRDGFFPHFFV-KDRE-FQILGKESDLVHHHEIF--VGFH 215 +I+G RDG F HF V K +E +Q LG ++ V H E+F V +H Sbjct: 424 RIWGYTVSYASRDGSFKHFLVEKIKEGYQFLG--TNQVVHDELFDLVAYH 471 >Z92838-2|CAB07408.1| 211|Caenorhabditis elegans Hypothetical protein T03D8.3 protein. Length = 211 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -1 Query: 226 VGFHVCVAVLAGLDVEVLGDFVVLS-FIVDLVN 131 V F V VA + GLD+E GDFV+ S +DL++ Sbjct: 8 VFFTVGVAAIYGLDLENAGDFVLPSGDFIDLIS 40 >U58086-1|AAC47123.1| 803|Caenorhabditis elegans CUL-4 protein. Length = 803 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 266 KNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQ 400 KN+ ++M +EAI LF+ FE +YK R+++ + Sbjct: 455 KNVSDDTTLDQMVDEAIVLFRYLRGKDVFEAYYKRGLAKRLFLER 499 >U29536-1|AAA68791.3| 840|Caenorhabditis elegans Cullin protein 4 protein. Length = 840 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 266 KNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQ 400 KN+ ++M +EAI LF+ FE +YK R+++ + Sbjct: 492 KNVSDDTTLDQMVDEAIVLFRYLRGKDVFEAYYKRGLAKRLFLER 536 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,862,897 Number of Sequences: 27780 Number of extensions: 214921 Number of successful extensions: 659 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -