BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31906 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 27 2.2 SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharo... 25 5.1 SPBC23G7.13c |||urea transporter |Schizosaccharomyces pombe|chr ... 25 6.7 SPAC23A1.02c |||phosphoprotein phosphatase |Schizosaccharomyces ... 25 6.7 SPAC22H10.08 |||DUF2009 protein|Schizosaccharomyces pombe|chr 1|... 25 8.9 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 26.6 bits (56), Expect = 2.2 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 7/48 (14%) Frame = +3 Query: 327 MVDSIGYSYADDRQ*KTINSNV-------HNMQIKCDIVYVLGIPIEL 449 +++ I SY D+ K +N V HN++IK + + LGIPIE+ Sbjct: 9 LLNKILGSYVDNLDTKQLNIGVWGGHVSLHNLRIKPEALDKLGIPIEI 56 >SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 488 Score = 25.4 bits (53), Expect = 5.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 458 LMLQFNWNAQHVNYVTFYLHVVYIAVYCFSLPIV 357 ++L N NYV F++ V+ CF +P+V Sbjct: 279 IILNSRKNLSLQNYVGFFVSVLDALFECFDVPVV 312 >SPBC23G7.13c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 664 Score = 25.0 bits (52), Expect = 6.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 344 IFVRRRSAMKNNKQQCTQHANKM*HSLRAG 433 IFV NN+ Q ++H N HS+R G Sbjct: 27 IFVSWSLKKFNNENQTSEHFNTASHSVRTG 56 >SPAC23A1.02c |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 25.0 bits (52), Expect = 6.7 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +1 Query: 49 RHLLHPGAAAGQPVAP-LLGDVLRCFSSTHSSPYDLMRCRQDKPTRRRSY-EDGGLNEPK 222 RHL+H GQP A LLGD++ F + ++ R K T +++ + G + P Sbjct: 87 RHLVHMNQFWGQPDAMILLGDLV-SFQHLDNEEFNKRAKRLKKITGAKNFWQVGNSSLPA 145 Query: 223 KNQKNTN 243 + +N N Sbjct: 146 RTFENGN 152 >SPAC22H10.08 |||DUF2009 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 492 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 381 LLFFIADRLRTNIQCCQPFKLFK 313 L++F+ D +R IQ F LFK Sbjct: 146 LMYFVQDSMRPEIQDALGFNLFK 168 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,937,912 Number of Sequences: 5004 Number of extensions: 37850 Number of successful extensions: 102 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -