BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31906 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY727759-1|AAW32090.1| 263|Homo sapiens KIR2DL4 protein. 31 3.2 AY725098-1|AAW32127.1| 263|Homo sapiens KIR2DL4 protein. 31 3.2 L13744-1|AAA58361.1| 568|Homo sapiens AF-9 protein. 30 4.2 BX649194-1|CAE46213.1| 298|Homo sapiens hypothetical protein pr... 30 4.2 BC036089-1|AAH36089.1| 568|Homo sapiens myeloid/lymphoid or mix... 30 4.2 AL512635-1|CAH70705.1| 568|Homo sapiens myeloid/lymphoid or mix... 30 4.2 AL354879-1|CAI14771.1| 568|Homo sapiens myeloid/lymphoid or mix... 30 4.2 Y13054-1|CAA73497.1| 342|Homo sapiens NK receptor protein. 29 7.3 X99481-1|CAA67844.1| 230|Homo sapiens NK receptor protein. 29 7.3 X99480-1|CAA67843.1| 377|Homo sapiens NK receptor protein. 29 7.3 X99479-1|CAA67842.1| 360|Homo sapiens NK receptor protein. 29 7.3 X97229-1|CAA65868.1| 377|Homo sapiens NK receptor protein. 29 7.3 X93596-1|CAA63792.1| 438|Homo sapiens NK receptor protein. 29 7.3 X93595-1|CAA63791.1| 455|Homo sapiens NK receptor protein. 29 7.3 U73394-1|AAC51146.1| 360|Homo sapiens NK-receptor protein. 29 7.3 U71199-1|AAB49756.1| 377|Homo sapiens natural killer cell recep... 29 7.3 L76666-1|AAB36594.1| 455|Homo sapiens protein ( Homo sapiens NK... 29 7.3 EF418613-1|ABN71372.1| 442|Homo sapiens killer cell immunoglobu... 29 7.3 EF103914-1|ABL14263.1| 367|Homo sapiens killer cell immunoglobu... 29 7.3 EF091490-1|ABO14699.1| 367|Homo sapiens KIR2DL4 protein. 29 7.3 EF091489-1|ABO14698.1| 367|Homo sapiens KIR2DL4 protein. 29 7.3 DQ371578-1|ABD38577.1| 377|Homo sapiens killer Ig receptor prot... 29 7.3 DQ371569-1|ABD38576.1| 273|Homo sapiens killer Ig receptor prot... 29 7.3 DQ272466-1|ABB84493.1| 182|Homo sapiens killer cell immunoglobu... 29 7.3 DQ266438-1|ABB73033.1| 377|Homo sapiens killer cell immunoglobu... 29 7.3 BC041611-1|AAH41611.1| 377|Homo sapiens KIR2DL4 protein protein. 29 7.3 AY789062-1|AAX23107.1| 375|Homo sapiens natural killer cell inh... 29 7.3 AY789061-1|AAX23106.1| 271|Homo sapiens truncated natural kille... 29 7.3 AY789060-1|AAX23105.1| 271|Homo sapiens truncated natural kille... 29 7.3 AY789059-1|AAX23104.1| 375|Homo sapiens natural killer cell inh... 29 7.3 AY789058-1|AAX23103.1| 375|Homo sapiens natural killer cell inh... 29 7.3 AY727763-1|AAW32094.1| 263|Homo sapiens KIR2DL4 protein. 29 7.3 AY727762-1|AAW32093.1| 367|Homo sapiens KIR2DL4 protein. 29 7.3 AY727761-1|AAW32092.1| 367|Homo sapiens KIR2DL4 protein. 29 7.3 AY727760-1|AAW32091.1| 367|Homo sapiens KIR2DL4 protein. 29 7.3 AY727758-1|AAW32089.1| 263|Homo sapiens KIR2DL4 protein. 29 7.3 AY727757-1|AAW32088.1| 263|Homo sapiens KIR2DL4 protein. 29 7.3 AY725105-1|AAW32126.1| 263|Homo sapiens KIR2DL4 protein. 29 7.3 AY725091-1|AAW32132.1| 263|Homo sapiens KIR2DL4 protein. 29 7.3 AY725085-1|AAW32129.1| 367|Homo sapiens KIR2DL4 protein. 29 7.3 AY725078-1|AAW32131.1| 367|Homo sapiens KIR2DL4 protein. 29 7.3 AY725063-1|AAW32128.1| 263|Homo sapiens KIR2DL4 protein. 29 7.3 AY721623-1|AAW32125.1| 263|Homo sapiens KIR2DL4 protein. 29 7.3 AY601812-1|AAT11793.1| 397|Homo sapiens natural killer cell imm... 29 7.3 AY359817-1|AAQ83723.1| 377|Homo sapiens KIR2DL4 protein. 29 7.3 AY250088-1|AAP02958.1| 352|Homo sapiens natural killer cell rec... 29 7.3 AY223515-1|AAO46037.1| 317|Homo sapiens natural killer cell rec... 29 7.3 AY223514-1|AAO46036.1| 248|Homo sapiens truncated natural kille... 29 7.3 AY223513-1|AAO46035.1| 352|Homo sapiens natural killer cell rec... 29 7.3 AY223512-1|AAO46034.2| 248|Homo sapiens truncated natural kille... 29 7.3 AY059420-1|AAL27095.1| 432|Homo sapiens killer-cell immunoglobu... 29 7.3 AY052498-1|AAL14213.1| 144|Homo sapiens NK cell receptor protein. 29 7.3 AY052497-1|AAL14212.1| 109|Homo sapiens NK cell receptor protein. 29 7.3 AY052496-1|AAL14211.1| 130|Homo sapiens truncated NK cell recep... 29 7.3 AM404443-1|CAL49525.1| 273|Homo sapiens killer cell immunoglobu... 29 7.3 AM404442-1|CAL49524.1| 273|Homo sapiens killer cell immunoglobu... 29 7.3 AM263059-1|CAK18998.1| 377|Homo sapiens killer cell immunoglobu... 29 7.3 AL133414-10|CAC40711.1| 377|Homo sapiens 1060P11.4.4 (killer ce... 29 7.3 AL133414-9|CAC40710.1| 247|Homo sapiens 1060P11.4.1 (killer cel... 29 7.3 AL133414-8|CAC40709.1| 360|Homo sapiens 1060P11.4.5 (killer cel... 29 7.3 AL133414-7|CAC40708.1| 230|Homo sapiens 1060P11.4.3 (killer cel... 29 7.3 AL133414-6|CAC40707.1| 325|Homo sapiens 1060P11.4.6 (killer cel... 29 7.3 AL133414-5|CAC40706.1| 342|Homo sapiens 1060P11.4.2 (killer cel... 29 7.3 AL133414-4|CAC40705.1| 220|Homo sapiens 1060P11.4.7 (killer cel... 29 7.3 AF285436-1|AAG34927.1| 377|Homo sapiens killer-cell Ig-like rec... 29 7.3 AF276292-1|AAG44820.1| 273|Homo sapiens killer cell immunoglobu... 29 7.3 AF110035-1|AAD24763.1| 377|Homo sapiens killer cell inhibitory ... 29 7.3 AF034773-1|AAB95166.1| 377|Homo sapiens natural killer cell inh... 29 7.3 AF034772-1|AAB95165.1| 377|Homo sapiens natural killer cell inh... 29 7.3 AF034771-1|AAB95164.1| 377|Homo sapiens natural killer cell inh... 29 7.3 AF003123-1|AAB61926.1| 377|Homo sapiens killer cell inhibitory ... 29 7.3 AF002982-1|AAB71390.1| 307|Homo sapiens killer cell receptor pr... 29 7.3 AF002981-1|AAB71389.1| 325|Homo sapiens killer cell receptor pr... 29 7.3 AF002980-1|AAB71388.1| 342|Homo sapiens killer cell receptor pr... 29 7.3 AF002979-1|AAB71387.1| 377|Homo sapiens killer cell receptor pr... 29 7.3 BC043617-1|AAH43617.1| 912|Homo sapiens DNA (cytosine-5-)-methy... 29 9.7 BC023612-1|AAH23612.1| 351|Homo sapiens DNMT3A protein protein. 29 9.7 AF480163-1|AAN40037.1| 689|Homo sapiens DNA cytosine methyltran... 29 9.7 AF331856-1|AAL57039.1| 909|Homo sapiens DNA cytosine methyltran... 29 9.7 AF135560-1|AAD48768.1| 203|Homo sapiens p58 killer cell inhibit... 29 9.7 AF067972-1|AAD33084.2| 912|Homo sapiens DNA cytosine methyltran... 29 9.7 AC012074-1|AAY14761.1| 912|Homo sapiens unknown protein. 29 9.7 AB208833-1|BAD92070.1| 811|Homo sapiens DNA cytosine methyltran... 29 9.7 >AY727759-1|AAW32090.1| 263|Homo sapiens KIR2DL4 protein. Length = 263 Score = 30.7 bits (66), Expect = 3.2 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A PV P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPVGPATHGETYRCFGSFHGSPYE 195 >AY725098-1|AAW32127.1| 263|Homo sapiens KIR2DL4 protein. Length = 263 Score = 30.7 bits (66), Expect = 3.2 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A PV P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPVGPATHGETYRCFGSFHGSPYE 195 >L13744-1|AAA58361.1| 568|Homo sapiens AF-9 protein. Length = 568 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 124 SSTHSSPYDLMRCRQDKPTRRRSYEDGGLNEPKK-NQKNTNNISKKP 261 S++ S P+ LM+ ++KP++ EP + + K++ SKKP Sbjct: 190 STSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKP 236 >BX649194-1|CAE46213.1| 298|Homo sapiens hypothetical protein protein. Length = 298 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 124 SSTHSSPYDLMRCRQDKPTRRRSYEDGGLNEPKK-NQKNTNNISKKP 261 S++ S P+ LM+ ++KP++ EP + + K++ SKKP Sbjct: 190 STSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKP 236 >BC036089-1|AAH36089.1| 568|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 568 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 124 SSTHSSPYDLMRCRQDKPTRRRSYEDGGLNEPKK-NQKNTNNISKKP 261 S++ S P+ LM+ ++KP++ EP + + K++ SKKP Sbjct: 190 STSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKP 236 >AL512635-1|CAH70705.1| 568|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 568 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 124 SSTHSSPYDLMRCRQDKPTRRRSYEDGGLNEPKK-NQKNTNNISKKP 261 S++ S P+ LM+ ++KP++ EP + + K++ SKKP Sbjct: 190 STSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKP 236 >AL354879-1|CAI14771.1| 568|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 568 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 124 SSTHSSPYDLMRCRQDKPTRRRSYEDGGLNEPKK-NQKNTNNISKKP 261 S++ S P+ LM+ ++KP++ EP + + K++ SKKP Sbjct: 190 STSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKP 236 >Y13054-1|CAA73497.1| 342|Homo sapiens NK receptor protein. Length = 342 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >X99481-1|CAA67844.1| 230|Homo sapiens NK receptor protein. Length = 230 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 69 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 110 >X99480-1|CAA67843.1| 377|Homo sapiens NK receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >X99479-1|CAA67842.1| 360|Homo sapiens NK receptor protein. Length = 360 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >X97229-1|CAA65868.1| 377|Homo sapiens NK receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >X93596-1|CAA63792.1| 438|Homo sapiens NK receptor protein. Length = 438 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 22 PNHEXHQPHRHLLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDL 153 P+H Q H + + G P+ P+L RC+ S SPY L Sbjct: 164 PSHLVGQIHDGVSKANFSIG-PLMPVLAGTYRCYGSVPHSPYQL 206 >X93595-1|CAA63791.1| 455|Homo sapiens NK receptor protein. Length = 455 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 22 PNHEXHQPHRHLLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDL 153 P+H Q H + + G P+ P+L RC+ S SPY L Sbjct: 164 PSHLVGQIHDGVSKANFSIG-PLMPVLAGTYRCYGSVPHSPYQL 206 >U73394-1|AAC51146.1| 360|Homo sapiens NK-receptor protein. Length = 360 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >U71199-1|AAB49756.1| 377|Homo sapiens natural killer cell receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >L76666-1|AAB36594.1| 455|Homo sapiens protein ( Homo sapiens NKAT4b mRNA, complete cds. ). Length = 455 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 22 PNHEXHQPHRHLLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDL 153 P+H Q H + + G P+ P+L RC+ S SPY L Sbjct: 164 PSHLVGQIHDGVSKANFSIG-PLMPVLAGTYRCYGSVPHSPYQL 206 >EF418613-1|ABN71372.1| 442|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 442 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 22 PNHEXHQPHRHLLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDL 153 P+H Q H + + G P+ P+L RC+ S SPY L Sbjct: 152 PSHLVGQIHDGVSKANFSIG-PLMPVLAGTYRCYGSVPHSPYQL 194 >EF103914-1|ABL14263.1| 367|Homo sapiens killer cell immunoglobulin-like receptor 2DL4 protein. Length = 367 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >EF091490-1|ABO14699.1| 367|Homo sapiens KIR2DL4 protein. Length = 367 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >EF091489-1|ABO14698.1| 367|Homo sapiens KIR2DL4 protein. Length = 367 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >DQ371578-1|ABD38577.1| 377|Homo sapiens killer Ig receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >DQ371569-1|ABD38576.1| 273|Homo sapiens killer Ig receptor protein. Length = 273 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >DQ272466-1|ABB84493.1| 182|Homo sapiens killer cell immunoglobulin-like receptor 2DL4 10A-B protein. Length = 182 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 73 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 114 >DQ266438-1|ABB73033.1| 377|Homo sapiens killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >BC041611-1|AAH41611.1| 377|Homo sapiens KIR2DL4 protein protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AY789062-1|AAX23107.1| 375|Homo sapiens natural killer cell inhibitory receptor protein. Length = 375 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 162 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 203 >AY789061-1|AAX23106.1| 271|Homo sapiens truncated natural killer cell inhibitory receptor protein. Length = 271 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 162 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 203 >AY789060-1|AAX23105.1| 271|Homo sapiens truncated natural killer cell inhibitory receptor protein. Length = 271 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 162 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 203 >AY789059-1|AAX23104.1| 375|Homo sapiens natural killer cell inhibitory receptor protein. Length = 375 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 162 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 203 >AY789058-1|AAX23103.1| 375|Homo sapiens natural killer cell inhibitory receptor protein. Length = 375 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 162 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 203 >AY727763-1|AAW32094.1| 263|Homo sapiens KIR2DL4 protein. Length = 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY727762-1|AAW32093.1| 367|Homo sapiens KIR2DL4 protein. Length = 367 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY727761-1|AAW32092.1| 367|Homo sapiens KIR2DL4 protein. Length = 367 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY727760-1|AAW32091.1| 367|Homo sapiens KIR2DL4 protein. Length = 367 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY727758-1|AAW32089.1| 263|Homo sapiens KIR2DL4 protein. Length = 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY727757-1|AAW32088.1| 263|Homo sapiens KIR2DL4 protein. Length = 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY725105-1|AAW32126.1| 263|Homo sapiens KIR2DL4 protein. Length = 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY725091-1|AAW32132.1| 263|Homo sapiens KIR2DL4 protein. Length = 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY725085-1|AAW32129.1| 367|Homo sapiens KIR2DL4 protein. Length = 367 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY725078-1|AAW32131.1| 367|Homo sapiens KIR2DL4 protein. Length = 367 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY725063-1|AAW32128.1| 263|Homo sapiens KIR2DL4 protein. Length = 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY721623-1|AAW32125.1| 263|Homo sapiens KIR2DL4 protein. Length = 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 154 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 195 >AY601812-1|AAT11793.1| 397|Homo sapiens natural killer cell immunoglobulin-like receptor protein. Length = 397 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 162 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 203 >AY359817-1|AAQ83723.1| 377|Homo sapiens KIR2DL4 protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AY250088-1|AAP02958.1| 352|Homo sapiens natural killer cell recpetor protein. Length = 352 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 139 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 180 >AY223515-1|AAO46037.1| 317|Homo sapiens natural killer cell receptor protein. Length = 317 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 139 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 180 >AY223514-1|AAO46036.1| 248|Homo sapiens truncated natural killer cell receptor protein. Length = 248 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 139 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 180 >AY223513-1|AAO46035.1| 352|Homo sapiens natural killer cell receptor protein. Length = 352 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 139 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 180 >AY223512-1|AAO46034.2| 248|Homo sapiens truncated natural killer cell receptor protein. Length = 248 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 139 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 180 >AY059420-1|AAL27095.1| 432|Homo sapiens killer-cell immunoglobulin-like receptor protein. Length = 432 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 22 PNHEXHQPHRHLLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDL 153 P+H Q H + + G P+ P+L RC+ S SPY L Sbjct: 141 PSHLVGQIHDGVSKANFSIG-PLMPVLAGTYRCYGSVPHSPYQL 183 >AY052498-1|AAL14213.1| 144|Homo sapiens NK cell receptor protein. Length = 144 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 21 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 62 >AY052497-1|AAL14212.1| 109|Homo sapiens NK cell receptor protein. Length = 109 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 21 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 62 >AY052496-1|AAL14211.1| 130|Homo sapiens truncated NK cell receptor protein. Length = 130 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 21 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 62 >AM404443-1|CAL49525.1| 273|Homo sapiens killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 protein. Length = 273 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AM404442-1|CAL49524.1| 273|Homo sapiens killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 protein. Length = 273 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AM263059-1|CAK18998.1| 377|Homo sapiens killer cell immunoglobulin-like receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AL133414-10|CAC40711.1| 377|Homo sapiens 1060P11.4.4 (killer cell immunoglobulin-like receptor, two domains, long cytopl protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AL133414-9|CAC40710.1| 247|Homo sapiens 1060P11.4.1 (killer cell immunoglobulin-like receptor, two domains, long cytopl protein. Length = 247 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 69 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 110 >AL133414-8|CAC40709.1| 360|Homo sapiens 1060P11.4.5 (killer cell immunoglobulin-like receptor, two domains, long cytopl protein. Length = 360 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AL133414-7|CAC40708.1| 230|Homo sapiens 1060P11.4.3 (killer cell immunoglobulin-like receptor, two domains, long cytopl protein. Length = 230 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 69 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 110 >AL133414-6|CAC40707.1| 325|Homo sapiens 1060P11.4.6 (killer cell immunoglobulin-like receptor, two domains, long cytopl protein. Length = 325 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AL133414-5|CAC40706.1| 342|Homo sapiens 1060P11.4.2 (killer cell immunoglobulin-like receptor, two domains, long cytopl protein. Length = 342 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AL133414-4|CAC40705.1| 220|Homo sapiens 1060P11.4.7 (killer cell immunoglobulin-like receptor, two domains, long cytopl protein. Length = 220 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF285436-1|AAG34927.1| 377|Homo sapiens killer-cell Ig-like receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF276292-1|AAG44820.1| 273|Homo sapiens killer cell immunoglobulin-like receptor KIR2DL4 protein. Length = 273 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF110035-1|AAD24763.1| 377|Homo sapiens killer cell inhibitory receptor G9P protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF034773-1|AAB95166.1| 377|Homo sapiens natural killer cell inhibitory receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF034772-1|AAB95165.1| 377|Homo sapiens natural killer cell inhibitory receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF034771-1|AAB95164.1| 377|Homo sapiens natural killer cell inhibitory receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF003123-1|AAB61926.1| 377|Homo sapiens killer cell inhibitory receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF002982-1|AAB71390.1| 307|Homo sapiens killer cell receptor protein. Length = 307 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF002981-1|AAB71389.1| 325|Homo sapiens killer cell receptor protein. Length = 325 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF002980-1|AAB71388.1| 342|Homo sapiens killer cell receptor protein. Length = 342 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >AF002979-1|AAB71387.1| 377|Homo sapiens killer cell receptor protein. Length = 377 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G+ RCF S H SPY+ Sbjct: 164 HELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYE 205 >BC043617-1|AAH43617.1| 912|Homo sapiens DNA (cytosine-5-)-methyltransferase 3 alpha protein. Length = 912 Score = 29.1 bits (62), Expect = 9.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 55 LLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDLMRCRQDKPTRRRSY 195 L+ PGAA A + D C+ H Y L+R R+D P+R + + Sbjct: 566 LVGPGAAQ----AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMF 608 >BC023612-1|AAH23612.1| 351|Homo sapiens DNMT3A protein protein. Length = 351 Score = 29.1 bits (62), Expect = 9.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 55 LLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDLMRCRQDKPTRRRSY 195 L+ PGAA A + D C+ H Y L+R R+D P+R + + Sbjct: 5 LVGPGAAQ----AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMF 47 >AF480163-1|AAN40037.1| 689|Homo sapiens DNA cytosine methyltransferase 3A2 protein. Length = 689 Score = 29.1 bits (62), Expect = 9.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 55 LLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDLMRCRQDKPTRRRSY 195 L+ PGAA A + D C+ H Y L+R R+D P+R + + Sbjct: 343 LVGPGAAQ----AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMF 385 >AF331856-1|AAL57039.1| 909|Homo sapiens DNA cytosine methyltransferase 3 alpha protein. Length = 909 Score = 29.1 bits (62), Expect = 9.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 55 LLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDLMRCRQDKPTRRRSY 195 L+ PGAA A + D C+ H Y L+R R+D P+R + + Sbjct: 563 LVGPGAAQ----AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMF 605 >AF135560-1|AAD48768.1| 203|Homo sapiens p58 killer cell inhibitory receptor KIR-K64 protein. Length = 203 Score = 29.1 bits (62), Expect = 9.7 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 28 HEXHQPHRHLLHPGAAAGQPVAPLL-GDVLRCFSSTHSSPYD 150 HE P ++ A P+ P G RCF S H SPY+ Sbjct: 146 HERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFHDSPYE 187 >AF067972-1|AAD33084.2| 912|Homo sapiens DNA cytosine methyltransferase 3 alpha protein. Length = 912 Score = 29.1 bits (62), Expect = 9.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 55 LLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDLMRCRQDKPTRRRSY 195 L+ PGAA A + D C+ H Y L+R R+D P+R + + Sbjct: 566 LVGPGAAQ----AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMF 608 >AC012074-1|AAY14761.1| 912|Homo sapiens unknown protein. Length = 912 Score = 29.1 bits (62), Expect = 9.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 55 LLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDLMRCRQDKPTRRRSY 195 L+ PGAA A + D C+ H Y L+R R+D P+R + + Sbjct: 566 LVGPGAAQ----AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMF 608 >AB208833-1|BAD92070.1| 811|Homo sapiens DNA cytosine methyltransferase 3 alpha isoform a variant protein. Length = 811 Score = 29.1 bits (62), Expect = 9.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 55 LLHPGAAAGQPVAPLLGDVLRCFSSTHSSPYDLMRCRQDKPTRRRSY 195 L+ PGAA A + D C+ H Y L+R R+D P+R + + Sbjct: 596 LVGPGAAQ----AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMF 638 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,117,628 Number of Sequences: 237096 Number of extensions: 1350360 Number of successful extensions: 3825 Number of sequences better than 10.0: 83 Number of HSP's better than 10.0 without gapping: 3556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3802 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -