BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31906 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 25 0.46 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 0.61 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 0.81 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 1.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.4 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 2.5 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 2.5 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 3.3 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 21 7.5 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 21 10.0 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 21 10.0 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 25.0 bits (52), Expect = 0.46 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 160 CRQDKPTRRRSYEDGGLNEPKKNQ 231 CR D P R Y+ GG++E +K++ Sbjct: 602 CR-DNPAERLGYQKGGISEIQKHK 624 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 24.6 bits (51), Expect = 0.61 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 271 HLSYL*VSFVQSRAFK*LEWLTALDIRTQTI 363 +LSY ++ + +R FK L +L LD+R +I Sbjct: 341 NLSYNMLTHIDARMFKDLFFLQILDLRNNSI 371 Score = 21.8 bits (44), Expect = 4.3 Identities = 8/28 (28%), Positives = 11/28 (39%) Frame = +1 Query: 118 CFSSTHSSPYDLMRCRQDKPTRRRSYED 201 CF+ H +D C P + Y D Sbjct: 743 CFALCHCCDFDACDCEMTCPAGCKCYND 770 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 24.2 bits (50), Expect = 0.81 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 94 PLLGDVLRCFSSTHSSPYDLMRCR 165 P + V +C + S PYD RCR Sbjct: 161 PSVKHVAKCATDFSSWPYDTHRCR 184 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 446 FNWNAQHVNYVTFYLHVVYIAVYCFSLPIVC 354 +N+N + NY Y +++ I +PI C Sbjct: 322 YNYNNYNNNYKPLYYNIINIEQIPVPVPIYC 352 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 1.4 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -3 Query: 148 RRAKNESTRSTSEHPRVEEPQAGQQQHQ 65 ++ + + + S+ P+ ++PQ QQQ Q Sbjct: 1510 QQQQQQQPQQQSQQPQQQQPQPQQQQQQ 1537 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 49 RHLLHPGAAA-GQPVAPLLGDVLRCFSS 129 RHLL G P PL+G+ L F S Sbjct: 35 RHLLELAEKIPGPPALPLIGNALDLFGS 62 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.6 bits (46), Expect = 2.5 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -1 Query: 414 HILFACCVHCC 382 H++ +CC CC Sbjct: 6 HVVMSCCCWCC 16 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 3.3 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +1 Query: 7 ANATMP---NHEXHQPHRHLLHPGAAAGQP 87 AN+ +P N PH+H H GAA P Sbjct: 6 ANSYIPDLRNGGVEHPHQHQQHYGAAVQVP 35 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 324 KLFKCSGLYKT 292 KL KC G YKT Sbjct: 118 KLLKCIGKYKT 128 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 324 KLFKCSGLYKT 292 KL KC G YKT Sbjct: 118 KLVKCFGKYKT 128 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 324 KLFKCSGLYKT 292 KL KC G YKT Sbjct: 118 KLVKCFGKYKT 128 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,721 Number of Sequences: 438 Number of extensions: 2685 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -