BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31904 (424 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-32... 130 3e-31 01_07_0285 - 42476767-42476832,42476990-42477603,42477821-424782... 130 3e-31 12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847,323... 129 8e-31 03_06_0585 - 34912159-34912224,34912634-34913247,34913350-349137... 129 1e-30 03_05_0926 + 28871800-28871859,28871943-28872336,28872586-288731... 128 2e-30 05_04_0450 - 21356877-21356942,21357482-21358095,21358173-213585... 128 2e-30 01_06_1455 + 37504175-37504231,37504357-37504750,37504865-375054... 128 2e-30 10_08_0597 + 19089616-19089675,19089789-19090182,19090451-190910... 126 6e-30 11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930,306... 114 3e-26 03_06_0192 + 32230953-32231030,32231130-32231485,32232250-322324... 60 1e-09 08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698,207... 58 4e-09 01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744,931... 52 2e-07 12_02_1282 + 27528159-27529148,27529549-27529614 52 3e-07 02_04_0473 + 23197294-23197340,23197443-23197680,23197792-231980... 46 1e-05 08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328,160... 44 5e-05 04_04_1515 + 34117383-34117732,34117833-34117918,34118227-341182... 42 2e-04 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 32 0.22 08_02_0441 - 17196352-17196536,17196780-17196906,17198018-171981... 31 0.51 08_02_0701 + 20177860-20178603 27 6.2 04_04_1136 - 31142742-31142806,31143245-31143325,31143432-311435... 27 8.2 03_06_0429 - 33863848-33864237,33864396-33864506,33864857-338649... 27 8.2 >05_01_0047 - 323097-323162,323287-323900,324233-324626,324718-324777 Length = 377 Score = 130 bits (315), Expect = 3e-31 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 DRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IV Sbjct: 313 DRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIV 372 Query: 242 HRKCF 228 HRKCF Sbjct: 373 HRKCF 377 >01_07_0285 - 42476767-42476832,42476990-42477603,42477821-42478214, 42478301-42478360 Length = 377 Score = 130 bits (315), Expect = 3e-31 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 DRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK+EYDESGP IV Sbjct: 313 DRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKDEYDESGPAIV 372 Query: 242 HRKCF 228 HRKCF Sbjct: 373 HRKCF 377 >12_01_0409 - 3230853-3230918,3231372-3231994,3232454-3232847, 3233000-3233059 Length = 380 Score = 129 bits (312), Expect = 8e-31 Identities = 58/65 (89%), Positives = 62/65 (95%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 DRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IV Sbjct: 316 DRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPAIV 375 Query: 242 HRKCF 228 HRKCF Sbjct: 376 HRKCF 380 >03_06_0585 - 34912159-34912224,34912634-34913247,34913350-34913734, 34913824-34913883 Length = 374 Score = 129 bits (311), Expect = 1e-30 Identities = 58/65 (89%), Positives = 62/65 (95%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 DRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IV Sbjct: 310 DRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIV 369 Query: 242 HRKCF 228 HRKCF Sbjct: 370 HRKCF 374 >03_05_0926 + 28871800-28871859,28871943-28872336,28872586-28873199, 28873281-28873346 Length = 377 Score = 128 bits (309), Expect = 2e-30 Identities = 57/65 (87%), Positives = 62/65 (95%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 DRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGP IV Sbjct: 313 DRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIV 372 Query: 242 HRKCF 228 HRKCF Sbjct: 373 HRKCF 377 >05_04_0450 - 21356877-21356942,21357482-21358095,21358173-21358566, 21358648-21358704 Length = 376 Score = 128 bits (308), Expect = 2e-30 Identities = 57/65 (87%), Positives = 62/65 (95%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 DRM KEIT+LAPS++K+K+IAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGPGIV Sbjct: 312 DRMSKEITSLAPSSMKVKVIAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPGIV 371 Query: 242 HRKCF 228 H KCF Sbjct: 372 HMKCF 376 >01_06_1455 + 37504175-37504231,37504357-37504750,37504865-37505478, 37506021-37506086 Length = 376 Score = 128 bits (308), Expect = 2e-30 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 DRM KEITALAP ++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPGIV Sbjct: 312 DRMSKEITALAPGSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIV 371 Query: 242 HRKCF 228 H KCF Sbjct: 372 HMKCF 376 >10_08_0597 + 19089616-19089675,19089789-19090182,19090451-19091064, 19091160-19091225 Length = 377 Score = 126 bits (305), Expect = 6e-30 Identities = 56/65 (86%), Positives = 62/65 (95%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 DRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWIS+ EY+ESGP IV Sbjct: 313 DRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISRAEYEESGPAIV 372 Query: 242 HRKCF 228 HRKCF Sbjct: 373 HRKCF 377 >11_01_0403 + 3059650-3059709,3059807-3060200,3060275-3060930, 3060979-3061044 Length = 391 Score = 114 bits (274), Expect = 3e-26 Identities = 58/79 (73%), Positives = 62/79 (78%), Gaps = 14/79 (17%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQ--------------QMW 285 DRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQ QMW Sbjct: 313 DRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQVNLTPTLYEVARMQMW 372 Query: 284 ISKEEYDESGPGIVHRKCF 228 ISK EYDESGP IVHRKCF Sbjct: 373 ISKGEYDESGPAIVHRKCF 391 >03_06_0192 + 32230953-32231030,32231130-32231485,32232250-32232425, 32233857-32234038,32234260-32234443,32235192-32235259, 32235343-32235495 Length = 398 Score = 59.7 bits (138), Expect = 1e-09 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 6/71 (8%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPE------RKYSVWIGGSILASLSTFQQMWISKEEYDE 261 DR +E L+ S I ++ PPE +YS W+GG+ILA + Q ++K +YDE Sbjct: 329 DRFQREAN-LSASAICPSLVKPPEYMPENLARYSAWLGGAILAKVVFPQNQHVTKGDYDE 387 Query: 260 SGPGIVHRKCF 228 +GP IVH+KCF Sbjct: 388 TGPSIVHKKCF 398 >08_01_0254 + 2078380-2078392,2078487-2078578,2079579-2079698, 2079924-2080097,2080184-2080257,2080847-2080927, 2081306-2081366,2081437-2081486,2082278-2082332, 2082599-2082676,2082757-2082810,2083703-2083756, 2083846-2083906,2084229-2084280,2085118-2085184, 2085393-2085452,2085546-2085608,2085752-2085814, 2086337-2086401,2086620-2086688,2086742-2086847 Length = 503 Score = 57.6 bits (133), Expect = 4e-09 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKEE 270 +R+ KE+ + ++K++A ER++SVWIGGSILASL +FQQMW SK + Sbjct: 416 ERLEKEVLEESSGNTRVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKAD 469 >01_01_1170 - 9318332-9318461,9318551-9318613,9318694-9318744, 9318837-9318921,9319005-9319068,9319139-9319340, 9319808-9320502 Length = 429 Score = 52.0 bits (119), Expect = 2e-07 Identities = 25/65 (38%), Positives = 36/65 (55%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 +R+ KE+ L P ++KIIA + W GGS+LA F+ M I+K EY+E G Sbjct: 364 ERLEKELRPLVPDDYQVKIIAQEDPILGAWRGGSLLAHRPDFESMCITKSEYEEMGSMRC 423 Query: 242 HRKCF 228 R+ F Sbjct: 424 RRRFF 428 >12_02_1282 + 27528159-27529148,27529549-27529614 Length = 351 Score = 51.6 bits (118), Expect = 3e-07 Identities = 33/65 (50%), Positives = 36/65 (55%) Frame = -3 Query: 422 DRMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIV 243 DRM KEITALAPS++KIK MWI+K EYDESGP IV Sbjct: 313 DRMSKEITALAPSSMKIK--------------------------MWIAKAEYDESGPSIV 346 Query: 242 HRKCF 228 HRKCF Sbjct: 347 HRKCF 351 >02_04_0473 + 23197294-23197340,23197443-23197680,23197792-23198016, 23198616-23198762,23198827-23198961,23199415-23199507, 23199925-23200044,23200303-23200413,23200486-23200611, 23200731-23200829,23201024-23201104 Length = 473 Score = 46.4 bits (105), Expect = 1e-05 Identities = 18/45 (40%), Positives = 31/45 (68%) Frame = -3 Query: 380 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGI 246 I++ +++ P ++Y+VW GGS+LAS + F + +K EY+E G I Sbjct: 418 IEVNVVSHPIQRYAVWFGGSVLASTAEFYEACHTKAEYEEYGASI 462 >08_01_0194 - 1603702-1603782,1603970-1604062,1604203-1604328, 1604403-1604513,1604989-1605108,1605665-1605757, 1606024-1606157,1606503-1606530,1606821-1607075, 1607167-1607401,1608147-1608193 Length = 440 Score = 44.0 bits (99), Expect = 5e-05 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 380 IKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGI 246 +++ ++A P + Y+ W GGS+ AS F + +KEEY+E G I Sbjct: 385 VEVNVVAHPIQSYAAWFGGSVAASNPEFYESCHTKEEYEEHGASI 429 >04_04_1515 + 34117383-34117732,34117833-34117918,34118227-34118297, 34118457-34118524,34118692-34118753,34119010-34119107, 34119545-34119626,34119935-34120077,34120233-34120381, 34120461-34120594,34120714-34120832,34120926-34121014, 34121398-34121515 Length = 522 Score = 41.9 bits (94), Expect = 2e-04 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 7/68 (10%) Frame = -3 Query: 422 DRMXKEITALAPSTIK--IKIIAPPERKYSVWIGGSILASLSTFQQMW-ISKEEYDE--- 261 +R+ KE+ L P+ I I++I PP S W G +++++STF + W I K+++ + Sbjct: 415 ERLEKELRELLPAHISEGIRVIPPPFGTDSAWFGAKMISNVSTFTEAWCIKKKQFRQKTR 474 Query: 260 -SGPGIVH 240 +GP V+ Sbjct: 475 RNGPSFVN 482 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 31.9 bits (69), Expect = 0.22 Identities = 16/62 (25%), Positives = 26/62 (41%) Frame = -3 Query: 419 RMXKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVH 240 R+ I P +K++ + W G + A+ S F + S +Y E G + H Sbjct: 641 RLESGIRQFRPYLSPLKLVRAADPLIDAWRGAAAFAASSKFGRHTFSLADYREHGENLFH 700 Query: 239 RK 234 RK Sbjct: 701 RK 702 >08_02_0441 - 17196352-17196536,17196780-17196906,17198018-17198101, 17198282-17198348,17198575-17198633,17199211-17199336, 17199406-17199474,17199545-17199653,17199692-17199760, 17199876-17199979,17200518-17200567,17200696-17200774, 17200867-17200938,17201083-17201217,17201311-17201421, 17202088-17202129 Length = 495 Score = 30.7 bits (66), Expect = 0.51 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = -3 Query: 380 IKIKIIAPPERKYSVWIGGSILASL 306 ++++I PP RK+ V++GG++LA + Sbjct: 366 LRLRIEDPPRRKHMVYLGGAVLAGI 390 >08_02_0701 + 20177860-20178603 Length = 247 Score = 27.1 bits (57), Expect = 6.2 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -2 Query: 420 QDAXGDHRPRALDHQDQDHRSPREEVLRMDR--WIHPGFPVHLPAD 289 QD D D+ D+DHRSP+ + R DR + G P H+ D Sbjct: 200 QDKEDDDDQGGGDYPDEDHRSPKRK-RRYDRGPCYNCGEPGHIARD 244 >04_04_1136 - 31142742-31142806,31143245-31143325,31143432-31143588, 31143695-31143809,31144016-31144083,31144171-31144314, 31144393-31144470,31144555-31144637,31144729-31144768, 31144993-31145067,31145202-31145314,31145839-31145878, 31145977-31146128,31146351-31146405,31146717-31146776, 31147005-31147268,31148379-31148436,31148606-31148637 Length = 559 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 291 LLEGGQGSQDGSTDPYG 341 LL GGQG++ GS+DP G Sbjct: 202 LLAGGQGTRLGSSDPKG 218 >03_06_0429 - 33863848-33864237,33864396-33864506,33864857-33864904, 33865666-33865785 Length = 222 Score = 26.6 bits (56), Expect = 8.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 234 LAVDDAGAGLVVFLLRDPHLLEGGQGSQDGSTD 332 L +DD+ A V DP+ GG+ QDG+T+ Sbjct: 107 LKIDDSSAAEVD--ANDPYTQSGGKNKQDGNTN 137 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,672,128 Number of Sequences: 37544 Number of extensions: 213025 Number of successful extensions: 542 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 778540620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -