BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31902 (516 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5BKB8 Cluster: Putative uncharacterized protein; n=2; ... 74 2e-12 UniRef50_A1CUU5 Cluster: Putative uncharacterized protein; n=2; ... 73 4e-12 UniRef50_UPI0000F2EBE8 Cluster: PREDICTED: similar to Ac1147; n=... 66 4e-10 UniRef50_A5BUD3 Cluster: Putative uncharacterized protein; n=1; ... 53 3e-06 UniRef50_A6NFT1 Cluster: Uncharacterized protein ENSP00000366514... 51 2e-05 UniRef50_Q972E3 Cluster: Putative uncharacterized protein ST1185... 48 1e-04 UniRef50_UPI0000E2C0B1 Cluster: conserved hypothetical protein; ... 47 3e-04 UniRef50_A4EB57 Cluster: Putative uncharacterized protein; n=6; ... 46 7e-04 UniRef50_UPI00005A9706 Cluster: PREDICTED: hypothetical protein ... 43 0.004 UniRef50_A0FH78 Cluster: Antifreeze protein; n=1; Saussurea invo... 43 0.005 UniRef50_Q6CQE3 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 41 0.019 UniRef50_Q57HV4 Cluster: ORF16-lacZ fusion protein; n=8; Bacteri... 40 0.034 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 35 0.96 UniRef50_UPI0000EBCD15 Cluster: PREDICTED: hypothetical protein;... 34 1.7 UniRef50_Q57L44 Cluster: ORF16-lacZ fusion protein; n=2; Bacteri... 34 2.2 UniRef50_UPI0001560201 Cluster: PREDICTED: hypothetical protein;... 33 2.9 UniRef50_UPI0000EBE980 Cluster: PREDICTED: hypothetical protein;... 33 2.9 UniRef50_Q1JSU4 Cluster: Putative uncharacterized protein; n=1; ... 33 5.1 UniRef50_UPI0000DBFC45 Cluster: UPI0000DBFC45 related cluster; n... 32 6.8 UniRef50_Q25AR7 Cluster: H0313F03.19 protein; n=3; Oryza sativa|... 32 6.8 UniRef50_Q4XM73 Cluster: 26S proteasome regulatory complex subun... 32 8.9 >UniRef50_A5BKB8 Cluster: Putative uncharacterized protein; n=2; Eukaryota|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 347 Score = 73.7 bits (173), Expect = 2e-12 Identities = 37/51 (72%), Positives = 40/51 (78%) Frame = +2 Query: 152 AIIPHKRGIPSKRES*ARVDYVPALCTHRPSLLPIE*FSEVFGPTRGGFTA 304 AI+ +RGIPSKR S ARVDYVPALCTHRPSLLPIE EVFG R G +A Sbjct: 36 AIVGLQRGIPSKRXSLARVDYVPALCTHRPSLLPIEWSGEVFGSRRRGRSA 86 >UniRef50_A1CUU5 Cluster: Putative uncharacterized protein; n=2; Neosartorya fischeri NRRL 181|Rep: Putative uncharacterized protein - Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181)) Length = 172 Score = 72.9 bits (171), Expect = 4e-12 Identities = 37/63 (58%), Positives = 41/63 (65%) Frame = +2 Query: 170 RGIPSKRES*ARVDYVPALCTHRPSLLPIE*FSEVFGPTRGGFTAVGVVGKLTKLDHLEE 349 RG S+ ES AR DYVPALCTHRPSLLPIE E FG +G + + GKL K HLEE Sbjct: 4 RGNNSRHESSARADYVPALCTHRPSLLPIEWLGEAFGLAQGSWQRLPRAGKLVKPGHLEE 63 Query: 350 VKV 358 V Sbjct: 64 NSV 66 >UniRef50_UPI0000F2EBE8 Cluster: PREDICTED: similar to Ac1147; n=1; Monodelphis domestica|Rep: PREDICTED: similar to Ac1147 - Monodelphis domestica Length = 510 Score = 66.1 bits (154), Expect = 4e-10 Identities = 35/54 (64%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +3 Query: 36 MPLDVLGRTRATLKESACS-PWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSAS 194 MPLDV G TRATL SAC+ P P G GNPL +R GD GLQL P+NEEF V S Sbjct: 1 MPLDVRGCTRATLTGSACAYPTPAGAGNPLNPIRDGDRGLQLFPMNEEFPVKDS 54 >UniRef50_A5BUD3 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 143 Score = 53.2 bits (122), Expect = 3e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 200 ARVDYVPALCTHRPSLLPIE*FSEVFG 280 ARVDYVPALCTHRPSLLPIE EVFG Sbjct: 14 ARVDYVPALCTHRPSLLPIEWSGEVFG 40 >UniRef50_A6NFT1 Cluster: Uncharacterized protein ENSP00000366514; n=39; Fungi/Metazoa group|Rep: Uncharacterized protein ENSP00000366514 - Homo sapiens (Human) Length = 95 Score = 50.8 bits (116), Expect = 2e-05 Identities = 27/51 (52%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +3 Query: 15 LSNNRSVMPLDVLGRTRATLKESAC-SPWPRGPGNPLKLLRAGDWGLQLSP 164 L NNRSV +D+ G T T S C SP P G G L +R GDWGLQL P Sbjct: 45 LGNNRSVTLIDIWGCTCTTPTGSVCASPTPAGAGKLLNPIRDGDWGLQLFP 95 >UniRef50_Q972E3 Cluster: Putative uncharacterized protein ST1185; n=1; Sulfolobus tokodaii|Rep: Putative uncharacterized protein ST1185 - Sulfolobus tokodaii Length = 109 Score = 48.0 bits (109), Expect = 1e-04 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = -1 Query: 258 SIGSSDGRCVQRAGT*STRAYDSRLLGIPRLWGIIANPNP 139 S+G SDGRCVQ AGT S R D RLLGIPR G ++ +P Sbjct: 36 SLGWSDGRCVQGAGTYSPRVVDPRLLGIPRSRGRVSALDP 75 Score = 33.1 bits (72), Expect = 3.9 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 397 MILPQVPLRKPCYDF 353 MI PQVPLR PCYDF Sbjct: 1 MIQPQVPLRLPCYDF 15 >UniRef50_UPI0000E2C0B1 Cluster: conserved hypothetical protein; n=1; Aspergillus terreus NIH2624|Rep: conserved hypothetical protein - Aspergillus terreus NIH2624 Length = 127 Score = 46.8 bits (106), Expect = 3e-04 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 418 HTIQHTLMILPQVPLRKPCYDFYFL 344 H H++MILPQV LRKPCYDFYFL Sbjct: 103 HKDPHSVMILPQVHLRKPCYDFYFL 127 >UniRef50_A4EB57 Cluster: Putative uncharacterized protein; n=6; Bacteria|Rep: Putative uncharacterized protein - Collinsella aerofaciens ATCC 25986 Length = 160 Score = 45.6 bits (103), Expect = 7e-04 Identities = 32/85 (37%), Positives = 39/85 (45%), Gaps = 2/85 (2%) Frame = +2 Query: 47 CPGPHARYTEGISMFSLA*RPGQ--PAETPSCWGLGFAIIPHKRGIPSKRES*ARVDYVP 220 CPG H Y + R G+ P P +GLG A PH+ G+ S R S R + VP Sbjct: 72 CPGLHTCYNGRYR--GMPPREGERIPESRPQ-FGLGAATRPHEVGVASNRGSACRGECVP 128 Query: 221 ALCTHRPSLLPIE*FSEVFGPTRGG 295 CTHRPS P + RGG Sbjct: 129 GPCTHRPSHHPSRLHPKSPAQPRGG 153 >UniRef50_UPI00005A9706 Cluster: PREDICTED: hypothetical protein XP_860064; n=1; Canis lupus familiaris|Rep: PREDICTED: hypothetical protein XP_860064 - Canis familiaris Length = 221 Score = 43.2 bits (97), Expect = 0.004 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -3 Query: 400 LMILPQVPLRKPCYDFYFL 344 LMILPQV LRKPCYDFYFL Sbjct: 203 LMILPQVHLRKPCYDFYFL 221 >UniRef50_A0FH78 Cluster: Antifreeze protein; n=1; Saussurea involucrata|Rep: Antifreeze protein - Saussurea involucrata Length = 200 Score = 42.7 bits (96), Expect = 0.005 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +3 Query: 174 EFLVSASHKLALITSLPFVHTARR 245 EFLVSASH+LAL TSLPFVHT R Sbjct: 124 EFLVSASHQLALTTSLPFVHTRGR 147 Score = 32.7 bits (71), Expect = 5.1 Identities = 25/63 (39%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +2 Query: 44 RCPGPHARYTEGISMFSLA*RPGQPAETPSCWGLGFAIIPHKR-GIPSKRES*ARVDYVP 220 RC GPH+ S+ R +P P+C G + G P ES ARVDYVP Sbjct: 62 RCSGPHS------SLHCCIRR--RPPTGPTCPGKPLIFSSGRAIGNPDLVESSARVDYVP 113 Query: 221 ALC 229 ALC Sbjct: 114 ALC 116 >UniRef50_Q6CQE3 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome D of strain NRRL Y- 1140 of Kluyveromyces lactis; n=3; Eukaryota|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome D of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 119 Score = 40.7 bits (91), Expect = 0.019 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -3 Query: 85 ADSFSVARVRPRTSKGITDLLL 20 A S SVARVRPRTSKGITDLLL Sbjct: 28 AGSVSVARVRPRTSKGITDLLL 49 >UniRef50_Q57HV4 Cluster: ORF16-lacZ fusion protein; n=8; Bacteria|Rep: ORF16-lacZ fusion protein - Salmonella choleraesuis Length = 106 Score = 39.9 bits (89), Expect = 0.034 Identities = 25/63 (39%), Positives = 31/63 (49%) Frame = +3 Query: 54 GRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLPFVH 233 G TRAT+ + S R G P K+ R+ DW LQL + E LV + T VH Sbjct: 34 GYTRATMAHTKRSDLARASG-PHKVRRSPDWSLQLDSMKLESLVIVDQNATVNTFPGLVH 92 Query: 234 TAR 242 TAR Sbjct: 93 TAR 95 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 35.1 bits (77), Expect = 0.96 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -1 Query: 279 PKTSLNHSIGSSDGRCVQRAGT*ST 205 P S SIG SDGRCVQRAGT S+ Sbjct: 65 PNNSSYLSIGRSDGRCVQRAGTHSS 89 >UniRef50_UPI0000EBCD15 Cluster: PREDICTED: hypothetical protein; n=1; Bos taurus|Rep: PREDICTED: hypothetical protein - Bos taurus Length = 177 Score = 34.3 bits (75), Expect = 1.7 Identities = 26/58 (44%), Positives = 29/58 (50%) Frame = -3 Query: 175 SSFMGDNCKPQSPARRSFSGLPGPLGQGEHADSFSVARVRPRTSKGITDLLLLNXRAA 2 SSF G +PQ+PA R GP QGE DS AR P +G DL LL AA Sbjct: 5 SSFKGK--RPQTPAPRPALWGSGPGSQGEGDDS-GPARFPPGLGRGAADLRLLCHPAA 59 >UniRef50_Q57L44 Cluster: ORF16-lacZ fusion protein; n=2; Bacteria|Rep: ORF16-lacZ fusion protein - Salmonella choleraesuis Length = 106 Score = 33.9 bits (74), Expect = 2.2 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +3 Query: 54 GRTRATLKESACSPWPRGPGNPLKLLRAGDWGLQLSPINEEFLVSASHKLALITSLP 224 G TRAT+ + S R G P K+ R+ DW LQL + E LV A + + P Sbjct: 20 GYTRATMAHTKRSDLARASG-PHKVRRSPDWSLQLDSMKSESLVIVDQN-ATVNTFP 74 >UniRef50_UPI0001560201 Cluster: PREDICTED: hypothetical protein; n=1; Equus caballus|Rep: PREDICTED: hypothetical protein - Equus caballus Length = 187 Score = 33.5 bits (73), Expect = 2.9 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 407 LYCV*YVNI-LFIYLYIYTHAYIRSFLIFIVY 499 +Y Y+ I ++IY YIYTH YI ++L +Y Sbjct: 89 IYIYPYIYIYIYIYTYIYTHIYICTYLYIYIY 120 >UniRef50_UPI0000EBE980 Cluster: PREDICTED: hypothetical protein; n=1; Bos taurus|Rep: PREDICTED: hypothetical protein - Bos taurus Length = 892 Score = 33.5 bits (73), Expect = 2.9 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -1 Query: 159 IIANPNPQHEGVSAGCPGL*ARENMLIPSV*RACGPG 49 + + P P H G SA PG R S RACGPG Sbjct: 663 LASTPGPDHRGRSASMPGPAGRRRRSSASRRRACGPG 699 >UniRef50_Q1JSU4 Cluster: Putative uncharacterized protein; n=1; Toxoplasma gondii|Rep: Putative uncharacterized protein - Toxoplasma gondii Length = 766 Score = 32.7 bits (71), Expect = 5.1 Identities = 11/24 (45%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +1 Query: 403 CVVLCVICKY-FIYLFIYIYACIH 471 C+ LC+I Y +IY+++Y Y CI+ Sbjct: 733 CMCLCIIYAYIYIYMYLYAYVCIY 756 >UniRef50_UPI0000DBFC45 Cluster: UPI0000DBFC45 related cluster; n=1; Rattus norvegicus|Rep: UPI0000DBFC45 UniRef100 entry - Rattus norvegicus Length = 272 Score = 32.3 bits (70), Expect = 6.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = +1 Query: 403 CVVLCVICKYFIYLF----IYIYACIHSIV 480 C+ +CV C YFI++F +YIY CI S V Sbjct: 102 CIFMCV-CVYFIFMFVGICVYIYTCICSSV 130 >UniRef50_Q25AR7 Cluster: H0313F03.19 protein; n=3; Oryza sativa|Rep: H0313F03.19 protein - Oryza sativa (Rice) Length = 434 Score = 32.3 bits (70), Expect = 6.8 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 81 SACSPWPRGPGNPLKLLRAGD--WGLQLSPINEEFLVSASHKLALI 212 S C PR G P K+ G+ WGLQ+ + L KLA+I Sbjct: 116 SYCQQRPRAAGGPHKITEVGEFVWGLQMKFVISGHLAKGHDKLAVI 161 >UniRef50_Q4XM73 Cluster: 26S proteasome regulatory complex subunit, putative; n=7; Plasmodium|Rep: 26S proteasome regulatory complex subunit, putative - Plasmodium chabaudi Length = 410 Score = 31.9 bits (69), Expect = 8.9 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +1 Query: 418 VICKYFIYLFIYIYACI 468 V+C Y+IY++IYIY C+ Sbjct: 383 VLCIYYIYIYIYIYICM 399 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 534,846,805 Number of Sequences: 1657284 Number of extensions: 11321711 Number of successful extensions: 31015 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 28099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30283 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -