BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31894 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) 39 0.003 SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) 34 0.060 SB_17530| Best HMM Match : EGF_CA (HMM E-Value=0) 34 0.060 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) 31 0.56 SB_38125| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 30 0.98 SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_6520| Best HMM Match : MANEC (HMM E-Value=2.2e-12) 30 1.3 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_20185| Best HMM Match : F5_F8_type_C (HMM E-Value=1.3e-23) 29 2.3 SB_35675| Best HMM Match : TB (HMM E-Value=8.4) 29 3.0 SB_23038| Best HMM Match : EGF_2 (HMM E-Value=2.8e-11) 29 3.0 SB_56860| Best HMM Match : Cadherin (HMM E-Value=4.4e-16) 29 3.0 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_331| Best HMM Match : F5_F8_type_C (HMM E-Value=0.034) 28 4.0 SB_48384| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 28 5.3 SB_32588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_21284| Best HMM Match : F5_F8_type_C (HMM E-Value=1.8e-21) 27 6.9 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 27 6.9 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 27 6.9 >SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 802 Score = 38.7 bits (86), Expect = 0.003 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = +1 Query: 94 CPENAHTTLNPCVPT--CADPEL---KHTSCVTAFIATCHCDSGYLFNSEG-KCVPVAEC 255 CP+ + N CV CADP++ +H T C C GY+ NS+G C + EC Sbjct: 691 CPQGYRSDWNKCVDIDECADPQVNKCQHICNNTQASFHCECREGYILNSDGITCSDIDEC 750 >SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) Length = 705 Score = 34.3 bits (75), Expect = 0.060 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Frame = +1 Query: 91 SCPENA--HTTLNPCVPTCADPELKHTSCVTAFIATCHCDSGYL--FNSEGK--CVPVAE 252 +CPENA + C TC DP ++ +C + C C ++ N+ GK C+ E Sbjct: 179 TCPENAVFKYCTSACPETCHDPPGRNKTCSMRCVEGCECKEEFVQRVNAVGKVQCIKRKE 238 Query: 253 C 255 C Sbjct: 239 C 239 >SB_17530| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 165 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +1 Query: 190 TCHCDSGYLFNSEGKCVPVAEC 255 TC C GY NS+GKC V EC Sbjct: 26 TCQCAEGYERNSQGKCADVNEC 47 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 32.3 bits (70), Expect = 0.24 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 190 TCHCDSGYLFNSEGKCVPVAEC 255 TC C GY +S+GKC V EC Sbjct: 483 TCQCAEGYERDSQGKCADVNEC 504 >SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1530 Score = 31.5 bits (68), Expect = 0.43 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +1 Query: 88 KSCPENAHTTLNPCVPTCADPELKHTSCVTA-FIATCHCDS-GYLFNSEGKCVPVAEC 255 K C + T C TC D +C + + C+C+ G L N+E KCV +C Sbjct: 1124 KQCNRDPLTRKLRCPSTCDDLANVTDTCPSRRCVEGCYCEKEGELMNNEHKCVDKTQC 1181 >SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 541 Score = 31.1 bits (67), Expect = 0.56 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Frame = +1 Query: 187 ATCHCDSGYLFNSEGK---CVPVAEC 255 A C C +GY N+EGK CV V EC Sbjct: 60 ARCECVAGYALNTEGKITRCVDVNEC 85 >SB_38125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 30.7 bits (66), Expect = 0.74 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = -3 Query: 508 SRYVSLNVSIFNFNFWIYVLLLRC--MDELTAHL 413 SRY+S+ +S +++ W+ V +RC D LTA L Sbjct: 304 SRYISIPISNYDYKKWVKVTGVRCTKQDSLTASL 337 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 193 CHCDSGYLFNSEGK-CVPVAEC*I*RGG 273 C CD GY S+GK C + EC I +GG Sbjct: 378 CACDYGYRLLSDGKTCQDIDECAINKGG 405 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/46 (26%), Positives = 19/46 (41%) Frame = +1 Query: 118 LNPCVPTCADPELKHTSCVTAFIATCHCDSGYLFNSEGKCVPVAEC 255 ++ C + +H T +C C GY + +CV V EC Sbjct: 561 IDECARNHGKGDCEHLCTNTVGSFSCSCHQGYRLKGKHQCVDVDEC 606 >SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 30.3 bits (65), Expect = 0.98 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 118 LNPCVPTCADPELKHTSCVTAFIA-TCHCDSGYLFNS-EGKCVPVAEC 255 ++ C+ + PE H+ C TC C+SGYL + + C+ V EC Sbjct: 285 MDECLVPGSCPE--HSVCTNHVKGFTCECESGYLMDDLKAHCIDVDEC 330 >SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3474 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 184 IATCHCDSGYLFNSEGKCVPVAEC 255 I C C GY S+G+CV + EC Sbjct: 292 IYQCTCFEGYHLTSDGQCVDINEC 315 >SB_6520| Best HMM Match : MANEC (HMM E-Value=2.2e-12) Length = 452 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +1 Query: 85 EKSCPENAHTTL---NPC-VPTCADPELKHTSCVTAFIATCH 198 ++ CP A T + NPC V +C P + SC +F TCH Sbjct: 157 DEDCPPGAPTAMCSSNPCDVASC--PGHPYASCKPSFCGTCH 196 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +1 Query: 190 TCHCDSGYLF-NSEGKCVPVAEC 255 TC C GY F NS +C+ + EC Sbjct: 2128 TCDCPRGYTFDNSSRRCIDINEC 2150 >SB_20185| Best HMM Match : F5_F8_type_C (HMM E-Value=1.3e-23) Length = 470 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -1 Query: 300 KYKSKSVEIASASYSTFGNGHAFSLRVEEVSRITVAGCDESRHATGVFQFRV 145 KY + V++ A Y+ F A S RI + GC A G+ FR+ Sbjct: 163 KYDTSKVDLTPAVYARFIRIAAISWETHVCMRIELYGCRACGDALGLEDFRI 214 >SB_35675| Best HMM Match : TB (HMM E-Value=8.4) Length = 251 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 489 MYLYLTSIFGYMFYCLDVWTS*QPT 415 M LY + IF Y+ YC+ VW S P+ Sbjct: 108 MTLYYSLIFPYLQYCICVWGSTYPS 132 >SB_23038| Best HMM Match : EGF_2 (HMM E-Value=2.8e-11) Length = 1477 Score = 28.7 bits (61), Expect = 3.0 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Frame = +1 Query: 31 IMFLLVSLMALAAS-KSLFEKSCPENAHTTLNPCVPTCADPELKHTSCVTAFIATCHCDS 207 I F SL +A S +S + NA T+ C TC + H CV TC CD Sbjct: 1311 ITFSPFSLRVVAMSVESTNGDTATSNATITITTCTYTCENNCSNHGQCVAR--DTCVCDQ 1368 Query: 208 GYLFN 222 + N Sbjct: 1369 KFSGN 1373 >SB_56860| Best HMM Match : Cadherin (HMM E-Value=4.4e-16) Length = 748 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 70 SKSLFEKSCPENAHTTLNPCVPTCADPELKHTSCVTAFI 186 S +L KS PEN+ T TC DPE + +C A + Sbjct: 656 SITLTNKSIPENSPTGTLVGTLTCEDPESPNDTCTFAIM 694 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 28.3 bits (60), Expect = 4.0 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +1 Query: 106 AHTTLNPC---VPTCADPELKHTSCV-TAFIATCHCDSGYLFNSEGKCVPVAEC 255 A T ++ C V TCA L ++C T TC C++GY N E C + EC Sbjct: 717 ACTDIDECTDGVHTCA---LNGSTCTNTVGSYTCACNAGYTGNGE-TCADIDEC 766 >SB_331| Best HMM Match : F5_F8_type_C (HMM E-Value=0.034) Length = 302 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -2 Query: 266 RHIQHSATGTHFPSELKRYPESQWQVAMKAVTQLVCFNSGSAQ 138 R +QH+ G+H + RY +A++ V C + G+A+ Sbjct: 217 RTVQHAHCGSHGTTRTLRYARYNTHIAVRTVQHAHCGSHGTAR 259 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -2 Query: 266 RHIQHSATGTHFPSELKRYPESQWQVAMKAVTQLVCFNSGSAQ 138 R +QH+ G+H + RY +A++ V C G+A+ Sbjct: 245 RTVQHAHCGSHGTARTLRYARYNTHIAVRTVQHAHCGTQGTAR 287 >SB_48384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1678 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 163 TSCVTAFIA-TCHCDSGYLFNSEGKCVPVAEC 255 + C+ + + C C GY N CV V EC Sbjct: 800 SQCINTYGSYKCSCKRGYAHNDSNVCVDVNEC 831 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 163 TSCVTAFIATCHCDSGYLFNSEGK-CVPVAEC 255 TS A + C C GYL S+G+ C V EC Sbjct: 2534 TSTCGAGLFRCSCRPGYLLMSDGRSCQDVDEC 2565 >SB_32588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1135 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 187 ATCHCDSGYLFNSEGKCVPVAE 252 +T D GYLF S G+ +PV++ Sbjct: 584 STLESDEGYLFGSNGQILPVSQ 605 >SB_21284| Best HMM Match : F5_F8_type_C (HMM E-Value=1.8e-21) Length = 564 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +1 Query: 118 LNPCVPTCADPELKHTSCVTAFIATCHCDSGYLFNSEGKCVPVAEC 255 +N CV T + + K + ++ C CD G+ NS+ K V C Sbjct: 387 VNECVETAHNCQQKCNNDYGSY--HCSCDPGFQLNSDKKTCSVIRC 430 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 187 ATCHCDSGYLFNSEGKCVPVAE 252 +T D GYLF S G+ +PV++ Sbjct: 47 STLESDEGYLFGSNGQILPVSQ 68 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 27.5 bits (58), Expect = 6.9 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = -1 Query: 300 KYKSKSVEIASASYSTFG-NGHAFSLRVEEVSRITVAGCDESR-HATGVFQFRVCTGRHA 127 K KS S + + S FG N H V E+ V G + R H T F R T RHA Sbjct: 374 KIKSTSEDKKTFVISNFGWNTHLNEGSVLEMPFNGVKGANGGRPHVTATFHARESTCRHA 433 Query: 126 GVQCRVSIFR 97 + V + R Sbjct: 434 SLALAVVLQR 443 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,796,169 Number of Sequences: 59808 Number of extensions: 334972 Number of successful extensions: 904 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -