BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31894 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 28 0.050 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 28 0.050 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 23 2.5 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 3.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 3.3 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 10.0 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 10.0 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 28.3 bits (60), Expect = 0.050 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 169 CVTAFIATCHCDSGYLFNSEGKCVPVAEC 255 C+ C C GYL N + CVP ++C Sbjct: 63 CIKICAPGCVCRLGYLRNKKKVCVPRSKC 91 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 28.3 bits (60), Expect = 0.050 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 169 CVTAFIATCHCDSGYLFNSEGKCVPVAEC 255 C+ C C GYL N + CVP ++C Sbjct: 63 CIKICAPGCVCRLGYLRNKKKVCVPRSKC 91 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 22.6 bits (46), Expect = 2.5 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 4/32 (12%) Frame = +2 Query: 254 VEYDAEAISTDFD----LYFIKKVYLTITKLY 337 V Y+ E +STD+D LYF + + + +Y Sbjct: 417 VNYNPETVSTDYDMSDRLYFEEISFEVVMDIY 448 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 Query: 202 DSGYLFNSEGK 234 DSGY+ N++GK Sbjct: 339 DSGYILNNDGK 349 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 Query: 202 DSGYLFNSEGK 234 DSGY+ N++GK Sbjct: 339 DSGYILNNDGK 349 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 282 VEIASASYSTFGNGHAFSLRVEEVSR 205 V A+ Y T G A ++ +++VSR Sbjct: 339 VRPATVQYDTCCQGRATAIYIDKVSR 364 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 20.6 bits (41), Expect = 10.0 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +1 Query: 43 LVSLMALAASKSLFEKSCPENAHTTLNPCVPTCADPELKHTSCV 174 + S++A AAS +L + PE+ T T P + S V Sbjct: 20 IASVVAGAASLTLVKAETPEHLAGTSTTAAATPTPPSVPVGSAV 63 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,776 Number of Sequences: 438 Number of extensions: 3095 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -