BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31885 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF026212-4|AAF99973.2| 386|Caenorhabditis elegans Hypothetical ... 29 2.0 Z48783-2|CAC42295.1| 805|Caenorhabditis elegans Hypothetical pr... 28 4.6 Z48783-1|CAA88701.1| 780|Caenorhabditis elegans Hypothetical pr... 28 4.6 AF233652-1|AAF63475.1| 780|Caenorhabditis elegans RFX-type tran... 28 4.6 AF226156-1|AAF61564.1| 805|Caenorhabditis elegans RFX-like tran... 28 4.6 Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical pr... 27 6.0 Z71262-12|CAA95808.1| 545|Caenorhabditis elegans Hypothetical p... 27 8.0 U70857-3|AAN84873.1| 950|Caenorhabditis elegans Na/ca exchanger... 27 8.0 U70857-2|AAM29660.1| 975|Caenorhabditis elegans Na/ca exchanger... 27 8.0 U70857-1|AAM29661.1| 925|Caenorhabditis elegans Na/ca exchanger... 27 8.0 AJ001181-1|CAA04574.1| 925|Caenorhabditis elegans sodium-calciu... 27 8.0 >AF026212-4|AAF99973.2| 386|Caenorhabditis elegans Hypothetical protein F52G3.5 protein. Length = 386 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 176 TTTCTRPRTRFSL-KKPARSRTLAPKTKASRSRDSTNTLAPT 298 TTT P T KK ++R+ PKT + + +T T APT Sbjct: 195 TTTTEEPSTTSEYRKKSKKNRSKRPKTTKTTTTSTTTTEAPT 236 >Z48783-2|CAC42295.1| 805|Caenorhabditis elegans Hypothetical protein F33H1.1b protein. Length = 805 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 106 PSGAGYDYKYGIIRYDNDVAPEGYHYLYETEN 201 P+G ++ Y I Y N V P G + LY ++ Sbjct: 178 PNGTREEFDYNQIEYGNAVTPNGTYTLYAPDS 209 >Z48783-1|CAA88701.1| 780|Caenorhabditis elegans Hypothetical protein F33H1.1a protein. Length = 780 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 106 PSGAGYDYKYGIIRYDNDVAPEGYHYLYETEN 201 P+G ++ Y I Y N V P G + LY ++ Sbjct: 153 PNGTREEFDYNQIEYGNAVTPNGTYTLYAPDS 184 >AF233652-1|AAF63475.1| 780|Caenorhabditis elegans RFX-type transcription factor DAF-19 short variant protein. Length = 780 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 106 PSGAGYDYKYGIIRYDNDVAPEGYHYLYETEN 201 P+G ++ Y I Y N V P G + LY ++ Sbjct: 153 PNGTREEFDYNQIEYGNAVTPNGTYTLYAPDS 184 >AF226156-1|AAF61564.1| 805|Caenorhabditis elegans RFX-like transcription factor DAF-19 protein. Length = 805 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 106 PSGAGYDYKYGIIRYDNDVAPEGYHYLYETEN 201 P+G ++ Y I Y N V P G + LY ++ Sbjct: 178 PNGTREEFDYNQIEYGNAVTPNGTYTLYAPDS 209 >Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical protein C29E6.1a protein. Length = 812 Score = 27.5 bits (58), Expect = 6.0 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 170 KATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTV 301 + TTT +P T S KK + T P K S+ +T T +P V Sbjct: 375 QVTTTTKKPSTTTSTKKLTTTTTTTP--KPSQKPTTTTTKSPVV 416 >Z71262-12|CAA95808.1| 545|Caenorhabditis elegans Hypothetical protein F22D6.3a protein. Length = 545 Score = 27.1 bits (57), Expect = 8.0 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 133 YGIIRY--DNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKV 267 YGII+ D AP+G+ + I AG ++NV E+ G+ V Sbjct: 178 YGIIKALPDGKSAPDGHELTVDYWEVIGKAPAGGIDNVLNESAGVDV 224 >U70857-3|AAN84873.1| 950|Caenorhabditis elegans Na/ca exchangers protein 2, isoformd protein. Length = 950 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 289 GPDGVTYRVDYTADENGFVADGAHIP 366 GPDG+T VDY ++ A +IP Sbjct: 391 GPDGLTVMVDYFTEDGSANAGSDYIP 416 >U70857-2|AAM29660.1| 975|Caenorhabditis elegans Na/ca exchangers protein 2, isoforma protein. Length = 975 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 289 GPDGVTYRVDYTADENGFVADGAHIP 366 GPDG+T VDY ++ A +IP Sbjct: 391 GPDGLTVMVDYFTEDGSANAGSDYIP 416 >U70857-1|AAM29661.1| 925|Caenorhabditis elegans Na/ca exchangers protein 2, isoformb protein. Length = 925 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 289 GPDGVTYRVDYTADENGFVADGAHIP 366 GPDG+T VDY ++ A +IP Sbjct: 394 GPDGLTVMVDYFTEDGSANAGSDYIP 419 >AJ001181-1|CAA04574.1| 925|Caenorhabditis elegans sodium-calcium exchanger protein. Length = 925 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 289 GPDGVTYRVDYTADENGFVADGAHIP 366 GPDG+T VDY ++ A +IP Sbjct: 394 GPDGLTVMVDYFTEDGSANAGSDYIP 419 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,503,156 Number of Sequences: 27780 Number of extensions: 159448 Number of successful extensions: 598 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -