BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31884 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC645.12c |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 28 0.72 SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom... 25 5.1 SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizos... 25 5.1 SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr 1||... 25 6.7 SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam... 25 8.9 >SPCC645.12c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 198 Score = 28.3 bits (60), Expect = 0.72 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 379 DNDVAPEGYHYLYETENKI 435 DND+ PE Y LYE E+K+ Sbjct: 132 DNDLEPEVYDILYEEESKL 150 >SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 1016 Score = 25.4 bits (53), Expect = 5.1 Identities = 17/65 (26%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = +2 Query: 134 DPVLLEVPEEPTSEPRRTSANTLVMLTRDPAXXXXXXXXXXXXXQSHPHTLPARWS---H 304 D +L + P P PR + + +LTRDP +HP W H Sbjct: 893 DAILSDEPLYPIHMPRDSVSILQQLLTRDPKKRLGSGPNDAEDVMTHPFFSNINWDDIYH 952 Query: 305 PHTLP 319 T P Sbjct: 953 KRTQP 957 >SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 282 Score = 25.4 bits (53), Expect = 5.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 1 PGRYVADPGRYDPSRDN 51 PG YV+D Y P +DN Sbjct: 236 PGSYVSDRASYTPQQDN 252 >SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1116 Score = 25.0 bits (52), Expect = 6.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 410 TCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNT 514 T RP + +LK P S + AP++ +S + S T Sbjct: 500 TVCRPHKKVTLKMPLNSGSSAPQSPSSNTSASVLT 534 >SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 24.6 bits (51), Expect = 8.9 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -2 Query: 497 LTLMPSFSVPTFSTLPASSARILFSVSYK*W*PSGATS 384 L++ PS S P FS + S+++ SVSY PS ++S Sbjct: 159 LSMSPS-STPVFSPSASVSSKVASSVSYVSSEPSDSSS 195 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.309 0.135 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,474,563 Number of Sequences: 5004 Number of extensions: 22095 Number of successful extensions: 48 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -