BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31878 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 29 0.55 SPCC895.08c |||conserved fungal protein|Schizosaccharomyces pomb... 27 1.3 SPBC119.14 |rti1||Rad22 homolog Rti1|Schizosaccharomyces pombe|c... 27 2.2 SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3 |Schizosaccha... 25 5.1 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 25 8.9 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 28.7 bits (61), Expect = 0.55 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +3 Query: 81 FVLFIAAAVSADDEPVLARLLVSKQVLNK 167 F+LFI+ A+S PVLAR+L +L+K Sbjct: 159 FLLFISTAMSITAFPVLARILSELHLLHK 187 >SPCC895.08c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 490 Score = 27.5 bits (58), Expect = 1.3 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -3 Query: 214 LNNVYFTSISIFSTKYLFSTCF 149 LN+ FTS+S+ S+KY F T F Sbjct: 156 LNDACFTSLSMKSSKYSFLTAF 177 >SPBC119.14 |rti1||Rad22 homolog Rti1|Schizosaccharomyces pombe|chr 2|||Manual Length = 371 Score = 26.6 bits (56), Expect = 2.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 210 FNVGSAPAVEVKLVDNGFHPDV 275 FNVG + V V L D FH DV Sbjct: 86 FNVGISVIVRVTLKDGSFHEDV 107 >SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 617 Score = 25.4 bits (53), Expect = 5.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 376 ISTSARRKSHTKPAKTPQTSNIRSAVLQEREPS*PSKI 489 + +RK TK + +I SAVL E +P SK+ Sbjct: 132 VGKEVQRKLRTKQLDLSKAESIISAVLGEEKPDPSSKV 169 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +3 Query: 93 IAAAVSADDEPVLARLLVSKQVLNKYLVENMDILVKY 203 IAA++ +D P + RL + +N Y++++ + Y Sbjct: 1989 IAASLKGEDIPSIQRLYCYEGPINNYMIKSWGSRLSY 2025 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,009,350 Number of Sequences: 5004 Number of extensions: 37274 Number of successful extensions: 142 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -