BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31878 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_6771| Best HMM Match : Aldedh (HMM E-Value=0) 30 0.98 SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 27 6.9 SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_49220| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) 27 9.2 SB_34286| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) 27 9.2 >SB_50161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 30.7 bits (66), Expect = 0.74 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 3/86 (3%) Frame = -3 Query: 412 ALYVTSAELKLK*PYLLDRTVTTWDTLV*---GAILSISAVSCPPTTVNTSGWKPLSTSF 242 +LYV L+ + P + D T ++ +V G +LSISAV+ P T + +SG + L Sbjct: 101 SLYVLQDLLQGEPPIVQDVTFSSEYLVVLLQSGLVLSISAVT-PDTAILSSG-RELVVKH 158 Query: 241 TSTAGALPTLNNVYFTSISIFSTKYL 164 +A A+PT NN T ++ S ++ Sbjct: 159 QDSAIAMPTGNNTIKTVATVESGGFI 184 >SB_6771| Best HMM Match : Aldedh (HMM E-Value=0) Length = 523 Score = 30.3 bits (65), Expect = 0.98 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -2 Query: 383 VEIAVLIGPDSHYMGYISLRCNPIDFRGQLSAYYSKHVRMEAVVHE 246 VE+ VL G + Y G + + +P D +++ Y HV EA+V E Sbjct: 54 VELPVLCGGEKVYTGNVKYQVSPFDHSNKIAKY---HVADEALVKE 96 >SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/63 (23%), Positives = 32/63 (50%) Frame = -2 Query: 491 IIFEGYDGSLSWSTADRILDVCGVFAGFVCDFRRAEVEIAVLIGPDSHYMGYISLRCNPI 312 I +GY G+ + + ++ G++ G +CD RR + + G ++G +L C+ Sbjct: 396 ICLDGYTGADCSLSKALVPELFGIYDGGLCDIRRRPCKKTDIFG--DGFIGSENLTCHST 453 Query: 311 DFR 303 +F+ Sbjct: 454 EFK 456 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 258 RCPRVSLQQPVRSQH*TMCILLVYPYSLLNI 166 R P L P+RS + T+ + L YPY+LL I Sbjct: 1437 RYPYALLTIPLRSTYDTLTLYLRYPYALLTI 1467 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 258 RCPRVSLQQPVRSQH*TMCILLVYPYSLLNI 166 R P L P+RS + T+ + L YPY+LL I Sbjct: 1459 RYPYALLTIPLRSTYDTLTLYLRYPYALLTI 1489 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 258 RCPRVSLQQPVRSQH*TMCILLVYPYSLLNI 166 R P L P+RS + T+ + L YPY+LL I Sbjct: 1481 RYPYALLTIPLRSTYDTLTLYLRYPYALLTI 1511 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 258 RCPRVSLQQPVRSQH*TMCILLVYPYSLLNI 166 R P L P+RS + T+ + L YPY+LL I Sbjct: 1503 RYPYALLTIPLRSTYDTLTLYLRYPYALLTI 1533 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 258 RCPRVSLQQPVRSQH*TMCILLVYPYSLLNI 166 R P L P+RS + T+ + L YPY+LL I Sbjct: 1525 RYPYALLTIPLRSTYDTLTLYLRYPYALLTI 1555 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 258 RCPRVSLQQPVRSQH*TMCILLVYPYSLLNI 166 R P L P+RS + T+ + L YPY LL I Sbjct: 1591 RYPYALLTVPLRSTYDTLTLYLRYPYPLLTI 1621 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 258 RCPRVSLQQPVRSQH*TMCILLVYPYSLLNI 166 R P L P+RS + T+ + L YPY+LL I Sbjct: 1547 RYPYALLTIPLRSTYDTLTLNLRYPYALLTI 1577 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 258 RCPRVSLQQPVRSQH*TMCILLVYPYSLLNI 166 R P L P+RS + T+ + L YPY+LL + Sbjct: 1569 RYPYALLTIPLRSTYGTLQLYLRYPYALLTV 1599 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = +1 Query: 364 ISTAISTSARRKSHTKPAKTPQTSNIRSAVLQEREPS*PS 483 +S+ + + ++HT PA+ P S++ + +Q R P+ P+ Sbjct: 267 LSSRETPPVQPRNHTCPAEKPHLSSLETPPVQPRNPTSPA 306 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 388 ARRKSHTKPAKTPQTSNIRSAVLQEREPS*PSKIMIESS 504 A+ ++ T PA+ P S+ + +Q+R P+ P+K SS Sbjct: 106 AQPRNPTSPAEKPHQSSKETQPVQQRNPAGPAKKPSRSS 144 >SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1050 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -3 Query: 313 SISAVSCPPTTVNTSGWKPLSTSFTSTAGALPTLNNV 203 SI A + TVN S W S TS+A L TL +V Sbjct: 872 SILATANKLHTVNRSVWNSTSQVMTSSAAVLSTLKDV 908 >SB_49220| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) Length = 207 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 511 CEENFLS*SLKATMAPSPGALLIEYWTSVASSLALYVTS 395 C E F S S + ++ + A+ + +SVA+ L +YVTS Sbjct: 14 CNEFFFSISHEVKVSLTAPAVFTSFLSSVANVLIIYVTS 52 >SB_34286| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) Length = 207 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 511 CEENFLS*SLKATMAPSPGALLIEYWTSVASSLALYVTS 395 C E F S S + ++ + A+ + +SVA+ L +YVTS Sbjct: 14 CNEFFFSISHEVKVSLTAPAVFTSFLSSVANVLIIYVTS 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,152,947 Number of Sequences: 59808 Number of extensions: 305910 Number of successful extensions: 746 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -