BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31877 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26100.2 68416.m03250 regulator of chromosome condensation (R... 29 1.4 At3g26100.1 68416.m03251 regulator of chromosome condensation (R... 29 1.4 At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid t... 28 3.2 At2g17230.1 68415.m01990 phosphate-responsive 1 family protein s... 27 7.5 At5g21990.1 68418.m02557 tetratricopeptide repeat (TPR)-containi... 27 9.9 At5g01720.1 68418.m00090 F-box family protein (FBL3) contains si... 27 9.9 At3g52710.1 68416.m05807 expressed protein predicted protein, Ar... 27 9.9 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 27 9.9 >At3g26100.2 68416.m03250 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 532 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -3 Query: 355 LSLGNVRCRRLESTLVSDVGHSVSNTVRADVRKFSAN 245 L G CRR +S V+ GHSV+ T + +V F N Sbjct: 134 LLAGEACCRREKSQAVAGPGHSVAVTSKGEVYTFGYN 170 >At3g26100.1 68416.m03251 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 432 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -3 Query: 355 LSLGNVRCRRLESTLVSDVGHSVSNTVRADVRKFSAN 245 L G CRR +S V+ GHSV+ T + +V F N Sbjct: 34 LLAGEACCRREKSQAVAGPGHSVAVTSKGEVYTFGYN 70 >At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein low similarity to glucoamylase S1/S2 [Precursor] from Saccharomyces cerevisiae [SP|P08640], proteophosphoglycan from Leishmania major [GI:5420387]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 256 Score = 28.3 bits (60), Expect = 3.2 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -1 Query: 285 VTPSGPMYANSPRTSRASFSVPMFFS*PVS*ALIPLEVS*PVLYPSTPMLSLS 127 +TPS P ++SP R S S PVS + P S P + S+P+++ S Sbjct: 151 ITPSSPAVSHSPPPVRHSSPPVSHSSPPVSHSSPPTSRSSPAVSHSSPVVAAS 203 >At2g17230.1 68415.m01990 phosphate-responsive 1 family protein similar to phi-1 (phosphate-induced gene) [Nicotiana tabacum] GI:3759184; contains Pfam profile PF04674: Phosphate-induced protein 1 conserved region Length = 363 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -3 Query: 493 FFFFFLLKRMYYHQDRITDRLDSNNKRKLFK*MSIFGLDAGACSVDL 353 FFFFF L +Y IT L +NN K ++ + + A + L Sbjct: 10 FFFFFTLSSFFY----ITSSLQNNNNNKHTATVNSLNIPSAAAEITL 52 >At5g21990.1 68418.m02557 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 554 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 266 IGPDGVTYAVTYVANEGGFQPSAPHIPKA 352 +G G + ++VA GF+PS P P A Sbjct: 413 LGASGSSSGNSFVAPRSGFEPSIPSAPPA 441 >At5g01720.1 68418.m00090 F-box family protein (FBL3) contains similarity to leucine-rich repeats containing F-box protein FBL3 GI:5919219 from [Homo sapiens] Length = 665 Score = 26.6 bits (56), Expect = 9.9 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 1/96 (1%) Frame = -3 Query: 460 YHQDRITDR-LDSNNKRKLFK*MSIFGLDAGACSVDLSLGNVRCRRLESTLVSDVGHSVS 284 Y QD ITD+ L S +K L + G S L+ VRC+RL + S++ Sbjct: 492 YCQD-ITDKSLVSLSKCSLLQTFESRGCP-NITSQGLAAIAVRCKRLAKVDLKKCP-SIN 548 Query: 283 NTVRADVRKFSANLKSFVFSANVLQLTGFLSLDSVG 176 + + FS NLK S + G LSL ++G Sbjct: 549 DAGLLALAHFSQNLKQINVSDTAVTEVGLLSLANIG 584 >At3g52710.1 68416.m05807 expressed protein predicted protein, Arabidopsis thaliana Length = 289 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 354 KSTEQAPASSPKILIHLKSFRLLLESKRSVIR 449 K AP S+P + S R+ L+SK S+IR Sbjct: 74 KGNSSAPISNPNTNPNSSSHRISLKSKASIIR 105 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 339 TFPRLKSTEQAPASSPKILIHLKS 410 TFP+L+S+E A A P ++ LKS Sbjct: 1899 TFPKLRSSEAATACIPHLIGALKS 1922 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,947,308 Number of Sequences: 28952 Number of extensions: 151319 Number of successful extensions: 364 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -