BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31873 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 27 0.13 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 3.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 3.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 3.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 3.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 3.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 3.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 3.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 3.7 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 4.9 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 6.5 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 6.5 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.6 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 8.6 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 8.6 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 26.6 bits (56), Expect = 0.13 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 69 RCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSP 164 R R VVPP C P+T+ P P D++ P Sbjct: 195 RSLRCVVPPTEDCDVPSTIPPPPPEEDDDSNIP 227 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 36 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 173 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASS 172 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 36 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 173 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 36 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 173 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 36 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 173 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 36 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 173 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 36 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 173 PP ++PS + + + P+S T P ++++ SP S Sbjct: 83 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 128 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 36 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 173 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 36 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 173 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.4 bits (43), Expect = 4.9 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +1 Query: 130 HRAHLRRIRTPPRHPASGLSRSRP 201 H+A +R + PP+ RS P Sbjct: 62 HKAPIRPVALPPKREIPSPKRSSP 85 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.0 bits (42), Expect = 6.5 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 84 VVPP-VSCWTPATVSPTPCPS-TKDTHSPTPS 173 V+PP + AT +P TKD SPTPS Sbjct: 22 VIPPHYNIHHGATPPQSPNQQYTKDCSSPTPS 53 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 6.5 Identities = 9/33 (27%), Positives = 13/33 (39%) Frame = -3 Query: 136 HGVGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 38 HG V G+ ++ +H LD D G Sbjct: 600 HGYAFNVVGIGRSPDQNVKKINLKHALDLDRRG 632 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 311 DFEQEMATAASSSSLEKSYELPDGQ 385 DF ++ +S L+ SY+ P Q Sbjct: 62 DFHSSSPSSDTSQDLQHSYQSPQTQ 86 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/33 (27%), Positives = 13/33 (39%) Frame = -3 Query: 136 HGVGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 38 HG V G+ ++ +H LD D G Sbjct: 600 HGYAFNVIGIGRSPDQNVKKINLKHALDLDRQG 632 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 312 TSSRKWPPLHPAAPSRSLTNFPTVRSS 392 +S+ +PP HP + S+ L + R+S Sbjct: 68 SSTSPYPPNHPLSGSKHLCSICGDRAS 94 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,723 Number of Sequences: 336 Number of extensions: 3130 Number of successful extensions: 15 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -