BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31868 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69860.1 68414.m08040 proton-dependent oligopeptide transport... 30 1.1 At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-rel... 30 1.1 At4g02780.1 68417.m00378 copalyl diphosphate synthase / CPS / en... 27 9.9 >At1g69860.1 68414.m08040 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 555 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = +2 Query: 368 DCVINYVSALSTLRKCFFCW----YWYRNF 445 DC +++ALSTL FF W Y YRN+ Sbjct: 522 DCFYYFIAALSTLNFIFFFWCARRYRYRNY 551 >At1g03060.1 68414.m00280 WD-40 repeat family protein / beige-related similar to BEIGE (GI:3928547) [Rattus norvegicus]; Similar to gb|U70015 lysosomal trafficking regulator from Mus musculus and contains 2 Pfam PF00400 WD-40, G-beta repeats. ESTs gb|T43386 and gb|AA395236 come from this gene Length = 3601 Score = 29.9 bits (64), Expect = 1.1 Identities = 8/20 (40%), Positives = 16/20 (80%) Frame = +2 Query: 416 FFCWYWYRNFCASRGRQTES 475 F CW+ +RNF ++G+++E+ Sbjct: 1091 FVCWFQFRNFLTTQGKESEA 1110 >At4g02780.1 68417.m00378 copalyl diphosphate synthase / CPS / ent-kaurene synthetase A (GA1) identical to GI:571330 [PMID: 7994182]; formerly called ent-kaurene synthetase A Length = 802 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/48 (25%), Positives = 29/48 (60%) Frame = -1 Query: 504 TNWKCLMKFNDSVCLPRDAQKFRYQYQQKKHLRSVDKALT*LITQSLA 361 T++ L + + +CLPR K R +++K ++S++K + ++ +L+ Sbjct: 714 THFVRLAEIINRICLPRQYLKARRNDEKEKTIKSMEKEMGKMVELALS 761 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,667,662 Number of Sequences: 28952 Number of extensions: 169969 Number of successful extensions: 287 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -