BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31862 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45819| Best HMM Match : DUF567 (HMM E-Value=5.7) 28 5.3 SB_24354| Best HMM Match : Galactosyl_T (HMM E-Value=5.6e-23) 27 9.2 >SB_45819| Best HMM Match : DUF567 (HMM E-Value=5.7) Length = 310 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -2 Query: 266 KQVFSLHYCFLF--IYLLNGIFLDSRAFLI 183 ++VF + CFL ++L+ G FLD FL+ Sbjct: 269 REVFLVEGCFLDREVFLVEGFFLDKEVFLV 298 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -2 Query: 266 KQVFSLHYCFLF--IYLLNGIFLDSRAFLI 183 ++VF + CFL ++L+ G FLD FL+ Sbjct: 197 REVFLVEGCFLDREVFLVEGFFLDREVFLV 226 >SB_24354| Best HMM Match : Galactosyl_T (HMM E-Value=5.6e-23) Length = 396 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/58 (27%), Positives = 22/58 (37%) Frame = +2 Query: 146 KMFKTMFYVTRSILRMLSSPRICHLXXXXXXXXXXXXTLVFKMHNVIKVNFCY*ICSY 319 K F RS + P ICH ++ HNV+ +N+ ICSY Sbjct: 326 KRFLPFVSCDRSYETLFQRP-ICHFKEPFVVHGVSEVQQIYMHHNVVVMNYVPTICSY 382 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,301,817 Number of Sequences: 59808 Number of extensions: 224340 Number of successful extensions: 315 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -