BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31860 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8902| Best HMM Match : DUF1070 (HMM E-Value=0.76) 29 2.3 SB_11417| Best HMM Match : zf-TAZ (HMM E-Value=0.91) 29 3.0 SB_2049| Best HMM Match : Ribosomal_LX (HMM E-Value=0.98) 27 6.9 SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_8902| Best HMM Match : DUF1070 (HMM E-Value=0.76) Length = 544 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 277 IFCRHCVSASFSVIRRRVAHDLSRERISLQP*EPSIRHKH 158 I CR C++ SV R A SR R+++ +PS+ H Sbjct: 186 IMCRQCIATGVSVCNRLSARHNSRLRLAMSQ-KPSVSFTH 224 >SB_11417| Best HMM Match : zf-TAZ (HMM E-Value=0.91) Length = 390 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = -3 Query: 277 IFCRHCVSASFSVIRRRVAHDLSRERISLQP*EPSIRHKHFTLPNHLAIITARKI 113 I CR C++ SV R A SR R+++ +PS+ FT+ + +I ++ Sbjct: 67 IMCRQCIATGVSVCNRLSARHNSRLRLAMSQ-KPSV---SFTIDDSFGVIDLSRL 117 >SB_2049| Best HMM Match : Ribosomal_LX (HMM E-Value=0.98) Length = 731 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 153 LYQITWPSSQLERYIRSTNTISDPSFGVVINTIS 52 LY+ SS +E +I S TI P F ++N +S Sbjct: 203 LYRALETSSLIEFFILSAETIVSPCFATLLNRLS 236 >SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1016 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 222 ATRRRITEKEADTQCRQKIYPEIRYCKVLNVIYS 323 ++RR+I E + QC + ++Y + N++YS Sbjct: 688 SSRRKIRSGEVEVQCTISVSQRMKYAENENLLYS 721 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,229,646 Number of Sequences: 59808 Number of extensions: 338867 Number of successful extensions: 874 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -