BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31858 (502 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|... 27 1.6 SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pomb... 26 3.7 >SPAC607.06c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 612 Score = 27.1 bits (57), Expect = 1.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 144 HSLHQIRFTYHSLWGLVSDPRKTLPTD 64 H L +RF YH + L SDP T P+D Sbjct: 357 HHLDMLRFFYHPCFKLPSDP--TYPSD 381 >SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1389 Score = 25.8 bits (54), Expect = 3.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 490 LTHYYTRVIILLNRKFDFTFDARIWDEISAWEHVHV 383 L H Y +++IL K + RIWD I +H+ Sbjct: 229 LLHMYNKLLILSEIKEKSHWRERIWDLIQGMVTLHI 264 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,026,931 Number of Sequences: 5004 Number of extensions: 40945 Number of successful extensions: 99 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -