BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31858 (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_5605| Best HMM Match : Peptidase_C2 (HMM E-Value=2e-13) 27 8.7 >SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 27.1 bits (57), Expect = 8.7 Identities = 19/78 (24%), Positives = 29/78 (37%) Frame = +2 Query: 5 QGKTFTNPKANNVNTLNGTESVGSVFLGSDTSPHREWYVNLI*CSECVFLTTMKIEN*KL 184 +G K + + G+ + + + P EWY N EC LT + EN Sbjct: 24 KGPPVFKQKLKDCKIIEGSAARFECQITGNPEPEVEWYRNGELLKECKQLTFLYDENDNC 83 Query: 185 KLRIVSKSGLDADNSTII 238 KL I DA ++ Sbjct: 84 KLIITEGKHADAGEYKVV 101 >SB_5605| Best HMM Match : Peptidase_C2 (HMM E-Value=2e-13) Length = 598 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -2 Query: 201 ETILNFNFQFSIFMVVKKTHSLHQIRFTYHSLWGLVSDPRK 79 ET+L+F F + + + L + +FTYHS W P+K Sbjct: 456 ETLLHF---FDV-VYMNWNPRLFEYKFTYHSTWAAQEGPKK 492 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,662,298 Number of Sequences: 59808 Number of extensions: 291387 Number of successful extensions: 546 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -