BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31857 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 24 1.1 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 2.5 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 10.0 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 10.0 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 10.0 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = -3 Query: 319 YLGSPHQVPATAVSMGMESAVPHTMPLRYLL 227 Y+ PHQ+ + + + P PL++L+ Sbjct: 611 YITEPHQIFSFPARLSLPKGQPQGFPLQFLV 641 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 135 FSELFCVLPPFVTRFHSGLEILTI 206 F E FC++ F + +LTI Sbjct: 122 FGEAFCIIQSFAAETSANATVLTI 145 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 368 LTCWLAF*IHINFV 327 L+CWL H NF+ Sbjct: 119 LSCWLQMTKHHNFI 132 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 343 FILIL*RVYLGSPHQVPATAVSM 275 F+L L R +L +P +PA S+ Sbjct: 389 FVLALVRPFLKNPDAIPAFLSSL 411 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 258 TADSIPMDTAVAGT 299 T S+P+ +AVAGT Sbjct: 53 TPPSVPVGSAVAGT 66 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,820 Number of Sequences: 438 Number of extensions: 2661 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -