BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31854 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-conta... 30 1.1 At2g27110.2 68415.m03258 far-red impaired responsive protein, pu... 29 1.9 At2g27110.1 68415.m03257 far-red impaired responsive protein, pu... 29 1.9 At5g65683.1 68418.m08265 zinc finger (C3HC4-type RING finger) fa... 29 2.5 At3g60800.1 68416.m06801 zinc finger (DHHC type) family protein ... 28 3.2 At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol spe... 27 9.9 At2g45640.1 68415.m05675 sin3 associated polypeptide p18 family ... 27 9.9 >At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 2554 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -3 Query: 316 GQVETLAVGSVEAR--GSKSVDEHASVDPFSHPARSPHENIEV 194 G+ ET++ G V+A GS V+E S DP S P ++P E + + Sbjct: 2332 GRRETMSSGEVKAEEIGSDGVNE--STDPSSLPGQTPQERVRL 2372 >At2g27110.2 68415.m03258 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 119 ETFVHT-NELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERIN 244 ETF HT N ++ + FRV + D ++ T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At2g27110.1 68415.m03257 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 119 ETFVHT-NELQMEEAVKVFRVLYYAKDFDVFMRTACWMRERIN 244 ETF HT N ++ + FRV + D ++ T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At5g65683.1 68418.m08265 zinc finger (C3HC4-type RING finger) family protein contains Pfam profiles PF00097: Zinc finger, C3HC4 type (RING finger), PF00092: von Willebrand factor type A domain Length = 717 Score = 28.7 bits (61), Expect = 2.5 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = -3 Query: 355 AVNEEVGIDLVRSGQVETLAVGSVEARGSKSVDEHASVDPFS-HPARSPHENIEVLSVVE 179 AVN G D +R ++ + G ++ + DE + P S + HE+ E VE Sbjct: 197 AVNNNFGSDPIRRPEIREIKTG--KSLRVYNDDEPLAYSPVSLAQINTIHESDEN-DDVE 253 Query: 178 DSEDFDGFF 152 D +DF GFF Sbjct: 254 DDDDFPGFF 262 >At3g60800.1 68416.m06801 zinc finger (DHHC type) family protein contains DHHC zinc finger domain PF01529 Length = 307 Score = 28.3 bits (60), Expect = 3.2 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = +2 Query: 410 VLWKYYGITVTDDNLVVIDWRKGVRRSLSQNDVMS 514 +LW Y+ + TD +V +WR ++D ++ Sbjct: 74 LLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLN 108 >At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol specific antioxidant (AhpC/TSA)/mal allergen family protein identical to SP|Q9M7T0 Putative peroxiredoxin, mitochondrial precursor {Arabidopsis thaliana}; similar to thioredoxin peroxidase [Capsicum annuum] GI:18654477; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 201 Score = 26.6 bits (56), Expect = 9.9 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = -3 Query: 295 VGSVEARGSKSVDEHASVDPFSHPARSPHENIEVLSVVEDSEDFDGFFHLELVGVDEGLS 116 + +A+G SV + DPF+ + E + +E DFDG FH L G+D+ LS Sbjct: 101 IDKFKAKGIDSVICVSVNDPFAINGWA--EKLGAKDAIEFYGDFDGKFHKSL-GLDKDLS 157 >At2g45640.1 68415.m05675 sin3 associated polypeptide p18 family protein similar to Sin3 associated polypeptide p18 (2HOR0202) (Swiss-Prot:O00422) [Homo sapiens] Length = 152 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 273 PRASTEPTARVSTCPLLTR 329 PR EP R TCPLL R Sbjct: 26 PRPKPEPVDREKTCPLLLR 44 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,257,412 Number of Sequences: 28952 Number of extensions: 192246 Number of successful extensions: 533 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -