BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31849 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce... 25 6.7 SPAPB1A10.09 |ase1||microtubule-associated protein Ase1 |Schizos... 25 8.9 >SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2310 Score = 25.0 bits (52), Expect = 6.7 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 422 STRYVRRGLGLLKFSSMKHLLTHERSFDKL 333 S+ YVR L+ FSS + LLT + DKL Sbjct: 332 SSDYVRIFHELVAFSSKRDLLTSAKRVDKL 361 >SPAPB1A10.09 |ase1||microtubule-associated protein Ase1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 731 Score = 24.6 bits (51), Expect = 8.9 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 58 EKLKSLLAEHMPRSLYEGLYTD*KIFCSNFYNANDKQLYRATYEKYLSFDFFT 216 EKL L EH+P L + +++ S FY+ ++ + YE ++ T Sbjct: 306 EKLHQLKKEHLPIFLEDCRQQILQLWDSLFYSEEQRKSFTPMYEDIITEQVLT 358 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,979,836 Number of Sequences: 5004 Number of extensions: 38184 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -