BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31848 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) 159 9e-40 SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) 159 2e-39 SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) 153 1e-37 SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) 141 4e-34 SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 1e-16 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 32 0.24 SB_33101| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 28 4.0 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 28 4.0 SB_33946| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_10621| Best HMM Match : Peptidase_M24 (HMM E-Value=4.3e-14) 27 6.9 SB_44299| Best HMM Match : IWS1_C (HMM E-Value=3.9) 27 9.2 SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_33836| Best HMM Match : PsbI (HMM E-Value=2) 27 9.2 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 159 bits (387), Expect = 9e-40 Identities = 78/129 (60%), Positives = 101/129 (78%) Frame = +1 Query: 124 RXELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVI 303 R L+ AKL+EQ +RYD+MA MKEV+E +LS EERNLLSV+YKN+VG RRSSWRVI Sbjct: 84 RETLIYNAKLSEQCDRYDEMAKIMKEVSEKYPKLSKEERNLLSVSYKNIVGQRRSSWRVI 143 Query: 304 SSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFYLKMK 483 SSIE+KT S + K+Y+ +EKEL+++C +VLG+L++ LIP A + E+KVFY K+K Sbjct: 144 SSIEEKTAESS-SLAIVKKYKACIEKELKDLCKEVLGILER-LIPGAEDEENKVFYFKLK 201 Query: 484 GDYYRYLAE 510 GDYYRYLAE Sbjct: 202 GDYYRYLAE 210 >SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 159 bits (385), Expect = 2e-39 Identities = 79/112 (70%), Positives = 86/112 (76%) Frame = +1 Query: 181 MAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKE 360 MA AMKE TE L EERNLLSVAYKNVVGA+RSSWRVISSIEQK EGSERK+Q + Sbjct: 1 MAKAMKEATEISETLEQEERNLLSVAYKNVVGAKRSSWRVISSIEQKLEGSERKKQNTET 60 Query: 361 YRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFYLKMKGDYYRYLAEVA 516 YR +E EL E+C VL LL+ LIP A + ESKVFYLKMKGDYYRY EVA Sbjct: 61 YRQTIENELNEVCETVLKLLESKLIPNAQSTESKVFYLKMKGDYYRYEGEVA 112 >SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) Length = 248 Score = 153 bits (370), Expect = 1e-37 Identities = 79/135 (58%), Positives = 97/135 (71%), Gaps = 3/135 (2%) Frame = +1 Query: 121 TRXELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRV 300 +R EL+ AK+AEQAERYDDM AM VT+ G L++EERNLLSVAYKNVVGARRSSWRV Sbjct: 10 SREELIHLAKMAEQAERYDDMVNAMSAVTKEGKPLNDEERNLLSVAYKNVVGARRSSWRV 69 Query: 301 ISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKAS---NPESKVFY 471 ISS+EQK E + K+YR + EL C +VL +L+ +L+ N E+KVFY Sbjct: 70 ISSMEQK--APEEMAALTKKYREDITNELNGKCAEVLDILENYLLKDGQDDINTEAKVFY 127 Query: 472 LKMKGDYYRYLAEVA 516 LKM+GDY+RYL EVA Sbjct: 128 LKMRGDYHRYLVEVA 142 >SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) Length = 251 Score = 141 bits (341), Expect = 4e-34 Identities = 72/122 (59%), Positives = 91/122 (74%), Gaps = 3/122 (2%) Frame = +1 Query: 124 RXELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVI 303 + E V AKLAEQAERYDDM +MKEV + G ELS E+RNLLSVAYKNV+GARR+SWR+I Sbjct: 4 KEEHVYMAKLAEQAERYDDMVNSMKEVAKMGTELSTEDRNLLSVAYKNVIGARRASWRII 63 Query: 304 SSIEQKTE--GSE-RKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFYL 474 +SIEQK E G + K +M + YR +E+EL+ IC ++L LLD LI + + ESKVFY Sbjct: 64 TSIEQKEESKGEDMAKLEMIRNYRKTIEEELKTICGEILSLLDDSLIKNSQSEESKVFYN 123 Query: 475 KM 480 K+ Sbjct: 124 KI 125 >SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 83.4 bits (197), Expect = 1e-16 Identities = 43/99 (43%), Positives = 63/99 (63%), Gaps = 2/99 (2%) Frame = +1 Query: 121 TRXELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRV 300 +R ELVQ AKLAEQ ER++D+ MK+ E L+ E RNLLSV YKNVVG++R +WR Sbjct: 189 SRNELVQLAKLAEQTERFEDVILYMKKAIEINPSLNKEHRNLLSVGYKNVVGSKRFAWRH 248 Query: 301 ISSIEQKTEGSERKQQMAK--EYRVKVEKELREICYDVL 411 + ++ R Q+ +Y+ K+E EL+ +C ++L Sbjct: 249 LHHDALQSGRYIRDSQLKGIIKYKEKIEMELKTLCREIL 287 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 32.3 bits (70), Expect = 0.24 Identities = 21/79 (26%), Positives = 37/79 (46%) Frame = +1 Query: 145 AKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKT 324 AK ++ ER + A K+ E + EE++ L K R+ + + IE+K Sbjct: 346 AKQKKEQERLEKQAEKEKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEKK 405 Query: 325 EGSERKQQMAKEYRVKVEK 381 + E+K+Q +E K E+ Sbjct: 406 KREEKKKQEEEEKMKKKEQ 424 >SB_33101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +1 Query: 91 VLFHRPRCPSTRXELVQRAKLAEQAERYDDMAAAMKEVT-ETGVELSNEERNLLSVAYK 264 V F P CP TR R +A Y A MK + + G ELS E+ + A K Sbjct: 314 VYFTTPPCPGTRATKPFRENIAALVVFYTPSKADMKAILHDYGAELSEEKMKVYMKALK 372 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 29.1 bits (62), Expect = 2.3 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 6/112 (5%) Frame = +1 Query: 133 LVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGAR------RSSW 294 L + K A +R +A+A+ + + + LS K VV + + W Sbjct: 282 LSEMFKQAVTEDRPKMLASAITKALNQDIHSPSALNLPLSTPAKQVVKTKWDRIREKHQW 341 Query: 295 RVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASN 450 ++S E+ +ER++Q E +VK E++ R+ ++ + HL K SN Sbjct: 342 NLLSEDEKNKIKAERRKQKRLELKVKREEKERKRLEELKRVSFAHLGMKLSN 393 >SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 512 Score = 28.3 bits (60), Expect = 4.0 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 1/85 (1%) Frame = +1 Query: 142 RAKLAEQAERYDDMAAAM-KEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQ 318 + K+ +++E+YD + + KE T+ G + E + N AR + ++ + Sbjct: 13 KRKIFKKSEKYDRLEEPLEKEGTDGGEIEAEAEVEPHTEEEANYNEARSENCEKNNNNDS 72 Query: 319 KTEGSERKQQMAKEYRVKVEKELRE 393 T ++ +Q KE+ V +EK+L++ Sbjct: 73 STPDAKSQQADIKEWIVSLEKQLKD 97 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 295 RVISSIEQKTEGSERKQQMAKEYRVKVEKELREIC 399 R++ IE+K E E ++ AKE + + E+E + IC Sbjct: 919 RIMKEIEEK-EKKEEAERKAKEEKEREERERKRIC 952 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +1 Query: 340 KQQMAKEYRVKVEKELREICYDVLGLLDKHLIPK 441 K++M ++Y K+EKE+ Y+++ L K ++ K Sbjct: 292 KEEMKEKYDGKIEKEMSGAIYEIISRLMKAVVGK 325 >SB_33946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 400 YDVLGLLDKHLIPKASNPESKVFYLKMKGDYY 495 YD ++ HL+P A +++ +K+ DYY Sbjct: 6 YDSNTVVSHHLLPSAQTRYIRIYPVKVNSDYY 37 >SB_10621| Best HMM Match : Peptidase_M24 (HMM E-Value=4.3e-14) Length = 708 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 169 RYDDMAAAMKEVTETGVELSNEERNLLSV 255 +YD++ AA+K+ T TG+ S + L V Sbjct: 57 KYDNLLAAVKDATNTGIRESGIDARLCDV 85 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 169 RYDDMAAAMKEVTETGVELSNEERNLLSV 255 +YD++ AA+K+ T TG+ S + L V Sbjct: 163 KYDNLLAAVKDATNTGIRESGIDARLCDV 191 >SB_44299| Best HMM Match : IWS1_C (HMM E-Value=3.9) Length = 454 Score = 27.1 bits (57), Expect = 9.2 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 1/90 (1%) Frame = +1 Query: 232 EERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVL 411 +ER + +V ++ ARRSS R + +++ TE + + E +V + R I Sbjct: 310 DERLVAAVVMQSRSEARRSSRRTMQTVQDTTENTLDRNN--NEIKVTKTQPSRRISVSDP 367 Query: 412 GLLDKH-LIPKASNPESKVFYLKMKGDYYR 498 LL + L+ + ++P + K + YR Sbjct: 368 KLLPRRPLVEETTSPSPNSLIEEAKTNKYR 397 >SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3464 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/72 (22%), Positives = 31/72 (43%) Frame = +1 Query: 118 STRXELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWR 297 + R +R L Q E D+ + KE+ E ++N + V + ARR + Sbjct: 2102 ANRAASYERKLLLLQQEEIADLRRSTKEIREKVKAEKPRDQNAVEVTHWYSADARREPYL 2161 Query: 298 VISSIEQKTEGS 333 ++S+ + G+ Sbjct: 2162 AVNSVARGNAGN 2173 >SB_33836| Best HMM Match : PsbI (HMM E-Value=2) Length = 241 Score = 27.1 bits (57), Expect = 9.2 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = +1 Query: 136 VQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRV-ISSI 312 + R +L++ Y MAA + E TE E + N+L+ + V A W + + Sbjct: 152 ISRDQLSQLLLVYVGMAADIMEFTEIIKEDEIRKVNMLN--NNHFVNAVILFWSMSLFQF 209 Query: 313 EQKTEGSERKQQMAKEYRVKVEKELRE 393 G+ER Q ++ + K+E+EL + Sbjct: 210 TLTISGTERTAQRLEKEKAKIEEELHK 236 >SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/43 (20%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +1 Query: 304 SSIEQKTEGSERKQQMAKEYRVKVE----KELREICYDVLGLL 420 +S+ +K E ++ + Y++K++ K+++++C+ V+G++ Sbjct: 20 NSLREKVERKTISNRITRNYKMKLQPMEIKDMKKLCFAVIGVI 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,297,165 Number of Sequences: 59808 Number of extensions: 273643 Number of successful extensions: 766 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -