BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31841 (302 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 1.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 2.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 2.5 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 2.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 20 5.8 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.6 bits (46), Expect = 1.1 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +1 Query: 115 NFCYCSYF*-IKLPIYVYN 168 N C +F IK PI++YN Sbjct: 89 NLAICDFFMMIKTPIFIYN 107 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 2.5 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +3 Query: 168 FLEFTPLESIYIYRPGV*KLWGPKSYYHVTR 260 F+E L + Y Y + W S YH+ + Sbjct: 224 FMEDVELNAYYYYMREMLPYWMSSSQYHMPK 254 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 2.5 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +3 Query: 168 FLEFTPLESIYIYRPGV*KLWGPKSYYHVTR 260 F+E L + Y Y + W S YH+ + Sbjct: 224 FMEDVELNAYYYYMREMLPYWMSSSQYHMPK 254 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 2.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 68 ILV*SNLTQLFNNALTIFAIVRTFELSFQFMYII 169 ILV LF N L I A+VR L Y I Sbjct: 192 ILVIVPCLTLFGNVLVILAVVRERALQTVTNYFI 225 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.2 bits (40), Expect = 5.8 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 86 LTQLFNNALTIFAIVRTFELSF 151 + ++ +ALT ++RTF S+ Sbjct: 249 IVEIAGDALTGLTVLRTFNASY 270 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,612 Number of Sequences: 438 Number of extensions: 1640 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6368931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -