BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31834 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024791-4|AAK95890.1| 1186|Caenorhabditis elegans Msh (muts hom... 28 3.4 AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical ... 28 4.6 Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical pr... 27 6.0 >AC024791-4|AAK95890.1| 1186|Caenorhabditis elegans Msh (muts homolog) family protein 6 protein. Length = 1186 Score = 28.3 bits (60), Expect = 3.4 Identities = 20/75 (26%), Positives = 32/75 (42%) Frame = +1 Query: 106 TRVVYYINTIIIPKHDHAVRAFLRPMRCDVLVFELTKKRAPWLILPVVICLSQRLSHACL 285 T + Y IN P +R++L CD E +K WL+ P S ++ A Sbjct: 593 TSLYYVINKCSTPFGRRLLRSWLLQPTCDPKKLEQRQKAIKWLVSPDA---SSFMTTATA 649 Query: 286 SASRIKAIPRMAQYI 330 + +I + R+ Q I Sbjct: 650 TLKKIPDLDRLLQKI 664 >AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical protein E04A4.6 protein. Length = 466 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 306 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 410 D+ G++ WF +++SV WI +V+ I +T+ Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258 >Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical protein C34C6.3 protein. Length = 520 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 348 SYSVTWITVVILELIHAIRTLTSDGMS 428 SY+V+WIT + IR + SDG++ Sbjct: 54 SYNVSWITPAASNSTYRIRLIDSDGLT 80 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,390,006 Number of Sequences: 27780 Number of extensions: 181291 Number of successful extensions: 421 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 421 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -