BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31833 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 3.7 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 4.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 4.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 4.9 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 8.6 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 3.7 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -1 Query: 282 RRERSAALGACTSEVEQFIVGCFHVVQGALDAVVDISSNTFA 157 R ++ A L AC+SEV F + + VQ D+++ +++ ++ Sbjct: 384 REDQIALLKACSSEVMMFRMARRYDVQ--TDSILFVNNQPYS 423 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 4.9 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -1 Query: 516 ALFCAFFVILQSTSGAADFRVTN 448 A FC VI G+ DF N Sbjct: 66 AFFCTALVIFYCQEGSVDFLFDN 88 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.9 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -1 Query: 516 ALFCAFFVILQSTSGAADFRVTN 448 A FC VI G+ DF N Sbjct: 299 AFFCTALVIFYCQEGSVDFLFDN 321 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.9 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -1 Query: 516 ALFCAFFVILQSTSGAADFRVTN 448 A FC VI G+ DF N Sbjct: 299 AFFCTALVIFYCQEGSVDFLFDN 321 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 20.6 bits (41), Expect = 8.6 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -3 Query: 184 CRHQLEYFR 158 CRH +EYF+ Sbjct: 148 CRHTVEYFQ 156 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.313 0.130 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,848 Number of Sequences: 336 Number of extensions: 1725 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits)
- SilkBase 1999-2023 -