BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31830 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57159| Best HMM Match : PI-PLC-X (HMM E-Value=0) 27 6.9 SB_3479| Best HMM Match : PAH (HMM E-Value=4.7) 27 9.2 >SB_57159| Best HMM Match : PI-PLC-X (HMM E-Value=0) Length = 1289 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -1 Query: 474 NICLGNFKINNEN*SPVAVRDVINVSVRILAGNL 373 N+ + NF ++NE SP D++ S R+ +G L Sbjct: 431 NLSISNFSLDNEYISPKDFNDILQFSNRMSSGIL 464 >SB_3479| Best HMM Match : PAH (HMM E-Value=4.7) Length = 222 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 147 IVCMRVCVKYMVVCVMFF 94 ++ +VCVKY VCVM++ Sbjct: 70 VMYYKVCVKYYKVCVMYY 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,703,409 Number of Sequences: 59808 Number of extensions: 238958 Number of successful extensions: 597 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -