BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31830 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 25 0.46 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 4.3 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 4.3 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 10.0 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 10.0 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 10.0 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 10.0 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 10.0 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 10.0 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 10.0 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 10.0 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 10.0 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 10.0 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 10.0 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 10.0 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 10.0 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 10.0 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 10.0 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 10.0 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 10.0 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 10.0 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 10.0 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 10.0 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 25.0 bits (52), Expect = 0.46 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = +3 Query: 273 ENTIIIVYKLTISIN--YSRISTTAGPLVYN 359 E+ +II+Y + ++ + +STT PL+YN Sbjct: 319 EDVLIIIYTILTYMSGVFYYLSTTVNPLLYN 349 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -3 Query: 352 TNGPAVVEIRL*LIEIVSLYTIMIVFS 272 T+GPA+V + L + I ++ I + +S Sbjct: 55 TDGPAIVRVNLFVRSIATISDIKMEYS 81 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 391 NFSGKFEFNVLLYTNG 344 N+ +++ NVL+Y NG Sbjct: 122 NYEVRYKSNVLIYPNG 137 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 97 NYNNYNKHNYNKLYYNINYIEQIPI 121 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +3 Query: 288 IVYKLTISINYSRISTTAGPLVYNNTLNSNFPL 386 I+ L+ + NY+ + PL YN P+ Sbjct: 81 IISSLSNNYNYNNYNNNYKPLYYNINYIEQIPV 113 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +3 Query: 288 IVYKLTISINYSRISTTAGPLVYNNTLNSNFPL 386 I+ L+ + NY+ + PL YN P+ Sbjct: 81 IISSLSNNYNYNNYNNNYKPLYYNINYIEQIPV 113 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +3 Query: 288 IVYKLTISINYSRISTTAGPLVYNNTLNSNFPL 386 I+ L+ + NY+ + PL YN P+ Sbjct: 81 IISSLSNNYNYNNYNNNYKPLYYNINYIEQIPV 113 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +3 Query: 288 IVYKLTISINYSRISTTAGPLVYNNTLNSNFPL 386 I+ L+ + NY+ + PL YN P+ Sbjct: 81 IISSLSNNYNYNNYNNNYKPLYYNINYIEQIPV 113 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 97 NYNNYNKHNYNKLYYNINYIEQIPI 121 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 97 NYNNYNKHNYNKLYYNINYIEQIPI 121 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 97 NYNNYNKHNYNKLYYNINYIEQIPI 121 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 97 NYNNYNKHNYNKLYYNINYIEQIPI 121 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 97 NYNNYNKHNYNKLYYNINYIEQIPI 121 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 97 NYNNYNKHNYNKLYYNINYIEQIPI 121 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 97 NYNNYNKHNYNKLYYNINYIEQIPI 121 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 97 NYNNYNKHNYNKLYYNINYIEQIPI 121 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +3 Query: 288 IVYKLTISINYSRISTTAGPLVYNNTLNSNFPL 386 I+ L+ + NY+ + PL YN P+ Sbjct: 314 IISSLSNNYNYNNYNNNYKPLYYNINYIEQIPV 346 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +3 Query: 288 IVYKLTISINYSRISTTAGPLVYNNTLNSNFPL 386 I+ L+ + NY+ + PL YN P+ Sbjct: 314 IISSLSNNYNYNNYNNNYKPLYYNINYIEQIPV 346 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +3 Query: 288 IVYKLTISINYSRISTTAGPLVYNNTLNSNFPL 386 I+ L+ + NY+ + PL YN P+ Sbjct: 314 IISSLSNNYNYNNYNNNYKPLYYNINYIEQIPV 346 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +3 Query: 288 IVYKLTISINYSRISTTAGPLVYNNTLNSNFPL 386 I+ L+ + NY+ + PL YN P+ Sbjct: 303 IISSLSNNYNYNNYNNNYKPLYYNINYIEQIPV 335 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 330 NYNNYNKHNYNKLYYNINYIEQIPI 354 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 281 NHNSVQAYNFN*L*SNFDYCGTISI 355 N+N+ +N+N L N +Y I I Sbjct: 330 NYNNYNKHNYNKLYYNINYIEQIPI 354 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 20.6 bits (41), Expect = 10.0 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +1 Query: 100 HYTHYHVFDAHT 135 HY HYH+ T Sbjct: 7 HYQHYHITPVFT 18 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,567 Number of Sequences: 438 Number of extensions: 3086 Number of successful extensions: 23 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -