BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31826 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02190.2 68414.m00150 CER1 protein, putative similar to CER1 ... 31 0.46 At1g02190.1 68414.m00149 CER1 protein, putative similar to CER1 ... 31 0.46 At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 31 0.61 At3g03480.1 68416.m00346 transferase family protein similar to h... 31 0.61 At1g10760.1 68414.m01231 starch excess protein (SEX1) identical ... 29 1.9 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 2.5 At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransfera... 28 3.2 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 28 3.2 At4g18030.1 68417.m02684 dehydration-responsive family protein s... 28 4.3 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 28 4.3 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 28 4.3 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 28 4.3 At3g47770.1 68416.m05204 ABC transporter family protein AbcA, Di... 27 7.5 At5g54350.1 68418.m06768 expressed protein ; expression support... 27 9.9 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 27 9.9 At5g09410.1 68418.m01090 calmodulin-binding protein similar to a... 27 9.9 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 27 9.9 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 27 9.9 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 27 9.9 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 27 9.9 >At1g02190.2 68414.m00150 CER1 protein, putative similar to CER1 GI:1199467 and maize gl1 homolog (glossy1 locus) GI:1209703 from [Arabidopsis thaliana] Length = 623 Score = 31.1 bits (67), Expect = 0.46 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 290 TNHSVIHSIAPFFLSTSNNLTCS-SRRSWSTMKENYSPIYLTFLTIH 153 TN+S+ I F T++NLT S RS +E+ I+LT LT H Sbjct: 257 TNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHLTTH 303 >At1g02190.1 68414.m00149 CER1 protein, putative similar to CER1 GI:1199467 and maize gl1 homolog (glossy1 locus) GI:1209703 from [Arabidopsis thaliana] Length = 627 Score = 31.1 bits (67), Expect = 0.46 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 290 TNHSVIHSIAPFFLSTSNNLTCS-SRRSWSTMKENYSPIYLTFLTIH 153 TN+S+ I F T++NLT S RS +E+ I+LT LT H Sbjct: 257 TNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHLTTH 303 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 30.7 bits (66), Expect = 0.61 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 320 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 436 D +G G+YG N +V + +SLE IV E+LN Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLN 62 >At3g03480.1 68416.m00346 transferase family protein similar to hypersensitivity-related gene GB:CAA64636 [Nicotiana tabacum]; contains Pfam transferase family domain PF00248 Length = 454 Score = 30.7 bits (66), Expect = 0.61 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%) Frame = -1 Query: 417 MPSRLMLPKGTYDGFPFQLF----VFVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLP 250 M ++ LP+ T G F++ V P +PTP+E +P S + D + G F PV+ Sbjct: 1 MDHQVSLPQSTTTGLSFKVHRQQRELVTPAKPTPRELKPL-SDIDDQQ--GLRFQIPVI- 56 Query: 249 QYFKQPNM 226 +F +PN+ Sbjct: 57 -FFYRPNL 63 >At1g10760.1 68414.m01231 starch excess protein (SEX1) identical to SEX1 [Arabidopsis thaliana] GI:12044358; supporting cDNA gi|12044357|gb|AF312027.1|AF312027 Length = 1399 Score = 29.1 bits (62), Expect = 1.9 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 299 TTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSV 445 T+DL G+ S +G Y SW G P+ V L E ++SE+ N +V Sbjct: 1089 TSDLVGAKSRNIG-YLKGKVPSWVGIPTSVALPFGVFEKVISEKANQAV 1136 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 28.7 bits (61), Expect = 2.5 Identities = 25/98 (25%), Positives = 37/98 (37%), Gaps = 1/98 (1%) Frame = -1 Query: 447 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 268 P ++NS P P Y P +VY P P PF V + P Y + Sbjct: 342 PPYVYNSPPPPPYYSPSPTVNYKSPPPP---YVYNSPPPPPYYSPFPKVEYKSPPPPYIY 398 Query: 267 DRPVLPQYFK-QPNMFFKKVLVYHEGELFPYLFNIPHY 157 + P P Y+ P + +K PY++ P+Y Sbjct: 399 NSPPPPPYYSPSPKITYKSPPP-------PYIYKTPYY 429 >At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransferase, putative similar to Swiss-Prot:P05055 polyribonucleotide nucleotidyltransferase (EC 2.7.7.8) (Polynucleotide phosphorylase) (PNPase) [Escherichia coli] Length = 991 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 275 IHSIAPFFLSTSNNLTCSSRRSWSTMKENYS 183 + S++P ST++NL S+ STMKEN S Sbjct: 877 LKSVSPKNNSTASNLVSFSKAKKSTMKENLS 907 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 28.3 bits (60), Expect = 3.2 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -1 Query: 354 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 217 +VY P P S P V + P Y + P P Y PN+++K Sbjct: 308 YVYSSPPPPYYS-PSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYK 352 >At4g18030.1 68417.m02684 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 621 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = -1 Query: 351 VYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGE 190 +Y P ++E + +VP K + PF P Y N FK + V G+ Sbjct: 113 IYRERHCPPDNEKLRCLVPAPKGYMTPFPWPKSRDYVHYANAPFKSLTVEKAGQ 166 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -1 Query: 354 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 217 +VY P P S P VV + P Y + P P Y P +++K Sbjct: 567 YVYSSPPPPYYS-PSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYK 611 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 320 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 436 D +G G+YG N +V + +SLE I E+LN Sbjct: 24 DEIGKGAYGRVYIGLDLENGDFVAIKQVSLENIGQEDLN 62 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 27.9 bits (59), Expect = 4.3 Identities = 22/77 (28%), Positives = 27/77 (35%) Frame = -1 Query: 447 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 268 P SS P PK TY P +VY P P P V + P Y + Sbjct: 710 PPPYVYSSPPPPYYSPSPKPTYKSPPPP---YVYSSPPPPPYYSPSPKVEYKSPPPPYVY 766 Query: 267 DRPVLPQYFKQPNMFFK 217 P P Y P + +K Sbjct: 767 SSPPPPYYSPSPKVEYK 783 Score = 27.5 bits (58), Expect = 5.7 Identities = 30/102 (29%), Positives = 38/102 (37%), Gaps = 3/102 (2%) Frame = -1 Query: 447 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 268 P SS P PK TY P +VY P P S P VV + P Y + Sbjct: 433 PPPYVYSSPPPPYYSPSPKLTYKSSPPP---YVYSSPPPPYYS-PSPKVVYKSPPPPYVY 488 Query: 267 DRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNI---PHYTP 151 P P Y P +K PY++N P+Y+P Sbjct: 489 SSPPPPYYSPSPKPSYKSPPP-------PYVYNSPPPPYYSP 523 >At3g47770.1 68416.m05204 ABC transporter family protein AbcA, Dictyostelium discoideum, U66526 Length = 900 Score = 27.1 bits (57), Expect = 7.5 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 5/63 (7%) Frame = -2 Query: 266 IAPFFLSTSN-----NLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALISKSKRTQ 102 +A FL+ +N NLT R WS ++ P+YL + + I+ +++L++ S Q Sbjct: 5 VAASFLTQANALFKKNLTYQKRNIWSNVRLIVIPLYLCVVLV-CIQAVFDSLVNNSVDNQ 63 Query: 101 TIC 93 C Sbjct: 64 CGC 66 >At5g54350.1 68418.m06768 expressed protein ; expression supported by MPSS Length = 279 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 293 SGTTDLNGSDSLGVGSYG*TNTNSWKG-NPSY 385 S T D+N +LG S+ TN +SW +PS+ Sbjct: 114 SSTNDINLDLTLGPSSWSNTNPSSWSNTDPSF 145 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -1 Query: 291 NKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPY 178 N GY F RP +P YF P + K PY Sbjct: 179 NPSMGYRFRRPFVPPYFYSPYGYGKAPRFRRPMRYMPY 216 >At5g09410.1 68418.m01090 calmodulin-binding protein similar to anther ethylene-upregulated calmodulin-binding protein ER1 GI:11612392 from [Nicotiana tabacum] Length = 1007 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = -2 Query: 260 PFFLSTSNNLTCSSRR-----SWSTMKENYSPIYLTFLTIHQIKRNYNALIS 120 PF+++ SN CS R S ST K N + +Y T+ ++ + +++ Sbjct: 479 PFYVTCSNRFACSEVREFDFLSGSTQKINATDVYGTYTNEASLQLRFEKMLA 530 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 26.6 bits (56), Expect = 9.9 Identities = 23/83 (27%), Positives = 31/83 (37%) Frame = -1 Query: 465 LDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNK 286 +D P SS P+ PK Y P +VY P P S P V + Sbjct: 341 VDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP---YVYSSPPPPYYS-PSPKVEYKSP 396 Query: 285 PFGYPFDRPVLPQYFKQPNMFFK 217 P Y + P P Y P +++K Sbjct: 397 PPPYVYSSPPPPTYSPSPKVYYK 419 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 26.6 bits (56), Expect = 9.9 Identities = 22/77 (28%), Positives = 29/77 (37%) Frame = -1 Query: 447 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 268 P SS P+ PK Y P +VY P P S P V + P Y + Sbjct: 447 PPPYVYSSPPPPTYSPSPKVDYKSPPPP---YVYSSPPPPYYS-PSPKVYYKSPPPPYVY 502 Query: 267 DRPVLPQYFKQPNMFFK 217 P P Y P +++K Sbjct: 503 SSPPPPYYSPSPKVYYK 519 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = -1 Query: 351 VYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 217 VY P P P V + P Y + P P Y P +++K Sbjct: 541 VYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYK 585 Score = 26.6 bits (56), Expect = 9.9 Identities = 23/77 (29%), Positives = 28/77 (36%) Frame = -1 Query: 447 PTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPF 268 P SS P PK Y P V V P P P P VV + P Y + Sbjct: 663 PPPYVYSSPPPPYYSPSPKVYYKSPPHP-HVCVCP--PPPPCYSPSPKVVYKSPPPPYVY 719 Query: 267 DRPVLPQYFKQPNMFFK 217 P P Y P +++K Sbjct: 720 SSPPPPHYSPSPKVYYK 736 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -1 Query: 354 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQP 232 +VYP P P S P P P+ YP P P Y P Sbjct: 408 YVYPSPPPPPPSPPPYVYPPPPPPYVYP--PPPSPPYVYPP 446 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 26.6 bits (56), Expect = 9.9 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 3/71 (4%) Frame = -1 Query: 354 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYL 175 +VY P P S P V + P Y + P P Y P VY++ PY+ Sbjct: 352 YVYSSPPPPYYS-PSPKVYYKSPPPPYVYSSPPPPYYSPSPK-------VYYKSPPPPYV 403 Query: 174 FNI---PHYTP 151 +N P+Y+P Sbjct: 404 YNSPPPPYYSP 414 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -1 Query: 354 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 217 +VY P P S P V + P Y + P P Y P +++K Sbjct: 452 YVYSSPPPPYYS-PSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYK 496 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -1 Query: 354 FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFK 217 +VY P P S P V + P Y + P P Y P +++K Sbjct: 477 YVYSSPPPPYYS-PSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYK 521 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,182,621 Number of Sequences: 28952 Number of extensions: 217217 Number of successful extensions: 820 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -