BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31823 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|... 31 0.077 SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Ma... 27 1.7 SPAC1039.07c |||4-aminobutyrate aminotransferase |Schizosaccharo... 27 1.7 SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyc... 26 3.8 SPBC409.12c |||nuclear telomere cap complex subunit Stn1|Schizos... 25 8.9 SPBC32H8.08c |||mannosyltransferase complex subunit |Schizosacch... 25 8.9 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 25 8.9 >SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 1752 Score = 31.5 bits (68), Expect = 0.077 Identities = 26/93 (27%), Positives = 38/93 (40%), Gaps = 3/93 (3%) Frame = +3 Query: 120 PDKYQYQYQTSNGISGQEQGALVNEGREDASIAVQG--SSGYTAPDGTPIQITYIADANG 293 PD + G G+E + G A+ +G S GYT+P + + Y + Sbjct: 1500 PDAAAFSPLVQGGSEGRE--GFGDYGLLGAASPYKGVQSPGYTSPFSSAMSPGYGLTSPS 1557 Query: 294 YQPSGAHLPTTPAPLP-IPDYIARAIEYIRTHP 389 Y PS T+PA +P P Y + Y T P Sbjct: 1558 YSPSSPGYSTSPAYMPSSPSYSPTSPSYSPTSP 1590 >SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Manual Length = 462 Score = 27.1 bits (57), Expect = 1.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 458 CFNNSRPYQLSYNLNTLADLWLGWM 384 CF+ P Q NL + A+LW WM Sbjct: 372 CFDGYLPAQERSNLKSKAELWNEWM 396 >SPAC1039.07c |||4-aminobutyrate aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 448 Score = 27.1 bits (57), Expect = 1.7 Identities = 20/84 (23%), Positives = 32/84 (38%) Frame = +3 Query: 90 QIVSQDADVFPDKYQYQYQTSNGISGQEQGALVNEGREDASIAVQGSSGYTAPDGTPIQI 269 Q+ ++ +D+ PD S G E + + + V SS + G + Sbjct: 96 QLATELSDLLPDGLDKTLFLSTGGEANEAALRMAKVYTNKYECVAFSSSWHGVTGGAASL 155 Query: 270 TYIADANGYQPSGAHLPTTPAPLP 341 T+ A GY P+ T P P P Sbjct: 156 TFAAARRGYGPALPGSYTIPEPNP 179 >SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.8 bits (54), Expect = 3.8 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = +3 Query: 180 ALVNEGREDASIAVQGSSGYTAPDGTPIQITYIADANGYQPSGAHLPTTPAP 335 AL+ G S VQ + YT+ G P T +A A + +G ++ +P Sbjct: 43 ALLPTGLLMGSPFVQSPTSYTSMHGLPFSTTQMAAAPAHPTTGYNVSRVTSP 94 >SPBC409.12c |||nuclear telomere cap complex subunit Stn1|Schizosaccharomyces pombe|chr 2|||Manual Length = 325 Score = 24.6 bits (51), Expect = 8.9 Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = -2 Query: 212 GCILTALVYERSLFLATDSVAGLILVLVF-VRENVSILRHNLGISFASAHDVRNVSDGYR 36 G I +YE L D +G++L +VF ++++ S+ + + +S + V + +R Sbjct: 54 GYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINSFR 113 Query: 35 DQSE 24 + E Sbjct: 114 SEVE 117 >SPBC32H8.08c |||mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = -3 Query: 157 PLLV*Y-WYWYLSGKTSASCD 98 PL+ Y WYW L + + SCD Sbjct: 214 PLMQQYEWYWRLEPEVTFSCD 234 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 24.6 bits (51), Expect = 8.9 Identities = 17/65 (26%), Positives = 27/65 (41%) Frame = +3 Query: 204 DASIAVQGSSGYTAPDGTPIQITYIADANGYQPSGAHLPTTPAPLPIPDYIARAIEYIRT 383 D + S G+ P P + + + Y+P ++L + PAP P P Y + Sbjct: 826 DEMASPSSSIGHPLPSPPPADFNSL-NVDFYEPH-SYLES-PAPEPQPSYEEESFNATVI 882 Query: 384 HPPKP 398 H P P Sbjct: 883 HAPTP 887 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,032,049 Number of Sequences: 5004 Number of extensions: 40596 Number of successful extensions: 128 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -